BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30144 (498 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.7 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 8.1 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 8.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +2 Query: 275 KPKAY*NSARIRPGKT 322 KPK Y SA + P KT Sbjct: 1552 KPKGYLLSAAVSPSKT 1567 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 20.6 bits (41), Expect = 8.1 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -1 Query: 300 ALF*YALGFRFINTRRSFLAQHPCSVYHLSSRLR 199 AL + GF ++T SF+A + H+ +L+ Sbjct: 273 ALLFFFAGFETVSTGVSFMAYELATNPHVQKKLQ 306 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 20.6 bits (41), Expect = 8.1 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 163 ALSSEYCPVFAAFITSVLTPDSLTHSE 83 AL +Y P AF+ + PDS+ E Sbjct: 191 ALKIKYNPFAKAFLDAKERPDSIYQRE 217 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,330 Number of Sequences: 336 Number of extensions: 2149 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -