BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30143 (674 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g11080.1 68417.m01800 high mobility group (HMG1/2) family pro... 51 6e-07 At5g23420.1 68418.m02747 high mobility group (HMG1/2) family pro... 50 2e-06 At4g23800.1 68417.m03422 high mobility group (HMG1/2) family pro... 48 8e-06 At3g51880.2 68416.m05690 high mobility group protein alpha (HMGa... 46 2e-05 At3g51880.1 68416.m05689 high mobility group protein alpha (HMGa... 46 2e-05 At1g20693.1 68414.m02592 high mobility group protein beta1 (HMGb... 46 2e-05 At3g28730.1 68416.m03587 structure-specific recognition protein ... 45 4e-05 At2g34450.1 68415.m04227 high mobility group (HMG1/2) family pro... 45 5e-05 At1g20696.1 68414.m02593 high mobility group protein beta2 (HMGb... 44 7e-05 At2g17560.1 68415.m02032 high mobility group protein gamma (HMGg... 40 0.001 At4g35570.1 68417.m05054 high mobility group protein delta (HMGd... 38 0.006 At5g23405.2 68418.m02742 high mobility group (HMG1/2) family pro... 32 0.30 At5g23405.1 68418.m02741 high mobility group (HMG1/2) family pro... 32 0.30 At1g55650.1 68414.m06370 high mobility group (HMG1/2) family pro... 29 3.8 At5g38460.1 68418.m04649 ALG6, ALG8 glycosyltransferase family p... 28 5.0 At1g77850.1 68414.m09072 transcriptional factor B3 family protei... 28 6.6 >At4g11080.1 68417.m01800 high mobility group (HMG1/2) family protein similar to SP|P40618 High mobility group protein HMG2A {Gallus gallus}; contains Pfam profile PF00505: HMG (high mobility group) box Length = 446 Score = 51.2 bits (117), Expect = 6e-07 Identities = 23/53 (43%), Positives = 35/53 (66%) Frame = +1 Query: 46 KKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKDK 204 KK+K KPK+P+SAY+++ N R +K EN V E+AK GE WK++ ++ Sbjct: 238 KKIKDPLKPKQPISAYLIYANERRAALKGENKS--VIEVAKMAGEEWKNLSEE 288 Score = 35.1 bits (77), Expect = 0.043 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +1 Query: 43 RKKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSM 195 +KK K + KRP + Y+LW ++K +NP E + G WK + Sbjct: 120 KKKKKDCAETKRPSTPYILWCKDNWNEVKKQNPEADFKETSNILGAKWKGI 170 Score = 34.3 bits (75), Expect = 0.075 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 64 DKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKDK 204 +KPK+P S+Y L+ AR+ + E+PG+ + + W + ++ Sbjct: 370 NKPKKPTSSYFLFCKDARKSVLEEHPGINNSTVTAHISLKWMELGEE 416 >At5g23420.1 68418.m02747 high mobility group (HMG1/2) family protein similar to high mobility group protein 2 HMG2 [Ipomoea nil] GI:1052956; contains Pfam profile PF00505: HMG (high mobility group) box Length = 241 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/54 (37%), Positives = 36/54 (66%) Frame = +1 Query: 43 RKKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKDK 204 +K ++KPKRP++A+ ++++ R+ KSE+ G + AK GGE WKS+ ++ Sbjct: 106 KKSSSTSNKPKRPLTAFFIFMSDFRKTFKSEHNGSLAKDAAKIGGEKWKSLTEE 159 >At4g23800.1 68417.m03422 high mobility group (HMG1/2) family protein similar to HMG2B [Homo sapiens] GI:32335; contains Pfam profile PF00505: HMG (high mobility group) box Length = 456 Score = 47.6 bits (108), Expect = 8e-06 Identities = 23/53 (43%), Positives = 33/53 (62%) Frame = +1 Query: 46 KKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKDK 204 KK K KPK P+SA++++ N R ++ EN V E+AK GE WK++ DK Sbjct: 247 KKEKDPLKPKHPVSAFLVYANERRAALREENKS--VVEVAKITGEEWKNLSDK 297 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = +1 Query: 37 AIRKKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSM 195 A +KK K + KRP S+Y+LW ++K ENP E + G WKS+ Sbjct: 127 ANKKKKKDCPETKRPSSSYVLWCKDQWTEVKKENPEADFKETSNILGAKWKSL 179 Score = 33.1 bits (72), Expect = 0.17 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +1 Query: 64 DKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKDK 204 +KPK+P S+Y L+ R+++ E PG + WK + ++ Sbjct: 377 NKPKKPASSYFLFSKDERKKLTEERPGTNNATVTALISLKWKELSEE 423 >At3g51880.2 68416.m05690 high mobility group protein alpha (HMGalpha) / HMG protein alpha nearly identical to HMG protein (HMGalpha) [Arabidopsis thaliana] GI:2832357; contains Pfam profile PF00505: HMG (high mobility group) box Length = 185 Score = 46.0 bits (104), Expect = 2e-05 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 43 RKKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLR-VTEIAKKGGEIWKSM 195 +K K +KPKR SA+ ++L R K ENP ++ V+ + K GG+ WKSM Sbjct: 44 KKAKKDPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSM 95 >At3g51880.1 68416.m05689 high mobility group protein alpha (HMGalpha) / HMG protein alpha nearly identical to HMG protein (HMGalpha) [Arabidopsis thaliana] GI:2832357; contains Pfam profile PF00505: HMG (high mobility group) box Length = 178 Score = 46.0 bits (104), Expect = 2e-05 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 43 RKKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLR-VTEIAKKGGEIWKSM 195 +K K +KPKR SA+ ++L R K ENP ++ V+ + K GG+ WKSM Sbjct: 44 KKAKKDPNKPKRAPSAFFVFLEDFRVTFKKENPNVKAVSAVGKAGGQKWKSM 95 >At1g20693.1 68414.m02592 high mobility group protein beta1 (HMGbeta1) / HMG protein beta1 nearly identical to HMG protein (HMGbeta1) [Arabidopsis thaliana] GI:2832359 Length = 144 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 55 KMTDKPKRPMSAYMLWLNSAREQIKSENP-GLRVTEIAKKGGEIWKSMKD 201 K +KPKRP SA+ +++ RE K ENP V + K G+ WKS+ D Sbjct: 33 KDPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSD 82 >At3g28730.1 68416.m03587 structure-specific recognition protein 1 / high mobility group protein / HMG protein nearly identical to SP|Q05153 Structure-specific recognition protein 1 homolog (HMG protein) {Arabidopsis thaliana}; contains Pfam profile PF00505: HMG (high mobility group) box; contains Pfam profile PF03531: Structure-specific recognition protein Length = 646 Score = 45.2 bits (102), Expect = 4e-05 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +1 Query: 46 KKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSM 195 KK K + PKR MS +M + R+ IK E+PG+ E+ K G+ W+ M Sbjct: 554 KKKKDPNAPKRAMSGFMFFSQMERDNIKKEHPGIAFGEVGKVLGDKWRQM 603 >At2g34450.1 68415.m04227 high mobility group (HMG1/2) family protein similar to HMG protein [Arabidopsis thaliana] GI:2832361; contains Pfam profile PF00505: HMG (high mobility group) box Length = 151 Score = 44.8 bits (101), Expect = 5e-05 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Frame = +1 Query: 43 RKKVKMTDK-PKRPMSAYMLWLNSAREQIKSENPGLR-VTEIAKKGGEIWKSM 195 +K VK+ K PK+P +A+ +L+ R+Q + ENP ++ + EI K GE WK+M Sbjct: 53 KKPVKLQTKMPKKPATAFFFFLDDFRKQYQEENPDVKSMREIGKTCGEKWKTM 105 >At1g20696.1 68414.m02593 high mobility group protein beta2 (HMGbeta2) / HMG protein beta2 nearly identical to HMG protein (HMGbeta2) [Arabidopsis thaliana] GI:2832361 Length = 141 Score = 44.4 bits (100), Expect = 7e-05 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +1 Query: 55 KMTDKPKRPMSAYMLWLNSAREQIKSENP-GLRVTEIAKKGGEIWKSMKD 201 K +KPKRP SA+ +++ R K E+P V + K GGE WKS+ D Sbjct: 30 KDPNKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSD 79 >At2g17560.1 68415.m02032 high mobility group protein gamma (HMGgamma) / HMG protein gamma nearly identical to HMG protein (HMGgamma) [Arabidopsis thaliana] GI:2832355 Length = 138 Score = 40.3 bits (90), Expect = 0.001 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +1 Query: 43 RKKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLR-VTEIAKKGGEIWKSMKDK 204 +K K ++PKRP SA+ ++L R++ NP + V + K G WK+M D+ Sbjct: 26 KKTKKDPNQPKRPPSAFFVFLEDFRKEFNLANPNNKSVATVGKAAGARWKAMTDE 80 >At4g35570.1 68417.m05054 high mobility group protein delta (HMGdelta) / HMG protein delta identical to HMG protein (HMGdelta) [Arabidopsis thaliana] GI:2832363 Length = 125 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Frame = +1 Query: 40 IRKKVKMTDKPKRPMSAYMLWLNSAREQIKSENPGLR-VTEIAKKGGEIWKSMKDK 204 + KK K ++PK+P S + ++L+ R++ NP + V + + G+ WK+M ++ Sbjct: 24 VGKKTKDPNRPKKPPSPFFVFLDDFRKEFNLANPDNKSVGNVGRAAGKKWKTMTEE 79 >At5g23405.2 68418.m02742 high mobility group (HMG1/2) family protein contains Pfam profile PF00505: HMG (high mobility group) box Length = 148 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 49 KVKMTDKPKRPMSA--YMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKD 201 K K T+K K S + +++N R+ +++ G V E +K G E+WKSM + Sbjct: 53 KKKPTNKKKSTTSLTDFAVFMNHFRKSFRTDYNGALVKEGSKIGWEMWKSMTE 105 >At5g23405.1 68418.m02741 high mobility group (HMG1/2) family protein contains Pfam profile PF00505: HMG (high mobility group) box Length = 149 Score = 32.3 bits (70), Expect = 0.30 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 49 KVKMTDKPKRPMSA--YMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKD 201 K K T+K K S + +++N R+ +++ G V E +K G E+WKSM + Sbjct: 54 KKKPTNKKKSTTSLTDFAVFMNHFRKSFRTDYNGALVKEGSKIGWEMWKSMTE 106 >At1g55650.1 68414.m06370 high mobility group (HMG1/2) family protein / ARID/BRIGHT DNA-binding domain-containing protein low similarity to Dead Ringer Protein Chain A Dna-Binding Domain (GI:6573608), Arid-Dna Complex (GI:20150982) from [Drosophila melanogaster]; contains Pfam profiles PF00505: HMG (high mobility group) box, PF01388: ARID/BRIGHT DNA binding domain Length = 337 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +1 Query: 70 PKRPMSAYMLWLNSAREQIKSENPGLRVTEIAKKGGEIWKSMKD 201 PKR + Y ++ +IK+EN G +V+ K G +W ++ + Sbjct: 215 PKRQRTGYNFFVAEQSVRIKAENAGQKVSS-PKNFGNMWTNLSE 257 >At5g38460.1 68418.m04649 ALG6, ALG8 glycosyltransferase family protein similar to SP|Q9Y672 Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase (EC 2.4.1.-) (Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase) {Homo sapiens}; contains Pfam profile PF03155: ALG6, ALG8 glycosyltransferase family Length = 533 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = -1 Query: 227 AAFCSHSVLSFIDFQISPPFLAISVTLNPGFSDFICSLALFNHSMYADIGRFGLSVILTF 48 A C VL+ + F ++ +S P F + L S + + G++VI+TF Sbjct: 219 AVLCESEVLTCVLFSLALSHKQMSAYFAPAFFSHLLGKCLRRKSPILSVIKLGIAVIVTF 278 Query: 47 FL 42 + Sbjct: 279 VI 280 >At1g77850.1 68414.m09072 transcriptional factor B3 family protein similar to auxin response factor 10 GI:6165644 from [Arabidopsis thaliana]; contains Pfam profile PF02362: B3 DNA binding domain Length = 585 Score = 27.9 bits (59), Expect = 6.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 221 FCSHSVLSFIDFQISPPFLAISVT 150 FC+ SV ++FQI PP + VT Sbjct: 139 FCADSVFPLLNFQIDPPVQKLYVT 162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,724,287 Number of Sequences: 28952 Number of extensions: 171530 Number of successful extensions: 439 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 426 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -