BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30142 (717 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 25 0.81 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 25 0.81 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 25 0.81 AY052623-1|AAL15471.1| 101|Tribolium castaneum kynurenine 3-mon... 23 2.5 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 23 3.3 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 7.6 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 24.6 bits (51), Expect = 0.81 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -3 Query: 172 KGNYIFVRRPFRLCPGGWTYSRTLPCGEDLLARTLSLMPNFFYKIF 35 +G ++ + P + WT + +P G+ R + + +F+YK F Sbjct: 217 RGQFMMIALPNK--DNSWTVTLFMPFGKFESLRNAAELKDFYYKTF 260 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 24.6 bits (51), Expect = 0.81 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -3 Query: 172 KGNYIFVRRPFRLCPGGWTYSRTLPCGEDLLARTLSLMPNFFYKIF 35 +G ++ + P + WT + +P G+ R + + +F+YK F Sbjct: 217 RGQFMMIALPNK--DNSWTVTLFMPFGKFESLRNAAELKDFYYKTF 260 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 24.6 bits (51), Expect = 0.81 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = -3 Query: 172 KGNYIFVRRPFRLCPGGWTYSRTLPCGEDLLARTLSLMPNFFYKIF 35 +G ++ + P + WT + +P G+ R + + +F+YK F Sbjct: 217 RGQFMMIALPNK--DNSWTVTLFMPFGKFESLRNAAELKDFYYKTF 260 >AY052623-1|AAL15471.1| 101|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 101 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 121 WTYSRTLPCGEDLLARTLSLMPNFFYKIF 35 WT + +P G+ R + + +F+YK F Sbjct: 14 WTVTLFMPFGKFESLRNAAELKDFYYKTF 42 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 22.6 bits (46), Expect = 3.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -3 Query: 157 FVRRPFRLCPGGWTYSRTLPCG 92 FV RL G W SRT CG Sbjct: 130 FVPLVQRLSAGDWFTSRTSACG 151 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/41 (21%), Positives = 19/41 (46%) Frame = +1 Query: 397 IFNLFKLYLMNTYYQIIIDKFGLSRSTLSNMVTNCVMPRES 519 +FN+ YL + ++ ++F L+ + NC +S Sbjct: 532 VFNVVHCYLASELVLMLKNRFVTLNVQLTKLTKNCATKAQS 572 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,212 Number of Sequences: 336 Number of extensions: 4031 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -