BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30142 (717 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19A8.03 |||phosphatidylinositol-3-phosphatase |Schizosacchar... 26 4.7 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 6.2 SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|... 26 6.2 >SPAC19A8.03 |||phosphatidylinositol-3-phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 559 Score = 26.2 bits (55), Expect = 4.7 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = -3 Query: 397 YSLPHLWKIFMVPTFQM---CLWQINDQF*EKFNNNSILL 287 +S+ H K+ M P F C+WQI DQF F N L Sbjct: 431 FSIDHSEKM-MSPVFHQFLDCVWQIMDQFPNCFEFNERFL 469 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 25.8 bits (54), Expect = 6.2 Identities = 11/23 (47%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 385 VVDC-IFNLFKLYLMNTYYQIII 450 VV C +FN+ L+L+ YYQI++ Sbjct: 157 VVICYVFNVLVLFLLARYYQIVM 179 >SPAC7D4.12c |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 759 Score = 25.8 bits (54), Expect = 6.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 379 WKIFMVPTFQMCLWQIN 329 WKI VP F +CL +N Sbjct: 599 WKILFVPLFTLCLLIVN 615 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,944,927 Number of Sequences: 5004 Number of extensions: 62781 Number of successful extensions: 151 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -