BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30142 (717 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1634 + 34937087-34937198,34937652-34937790,34938263-349383... 30 2.1 01_07_0205 - 41978437-41980599,41980805-41981215 29 3.7 >04_04_1634 + 34937087-34937198,34937652-34937790,34938263-34938334, 34938414-34938546,34938591-34938730,34939478-34939585, 34939650-34939720,34940297-34940545,34940618-34940823, 34940894-34941026,34941099-34941101,34941136-34941293, 34941420-34941683,34941869-34942114 Length = 677 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +2 Query: 107 P*VRPSSWAKPERSSDKYVVTFESLQKKLVGATSSIRIRVSCKACMNVAWASTSRLINK 283 P +R SSW + + SD+ V +S K + S + V+C+ N+ +S ++ K Sbjct: 320 PSIRISSWNRSKSWSDEITVLIDSDMLKSLPKLSRQELEVACEDFSNIIGSSPETVVYK 378 >01_07_0205 - 41978437-41980599,41980805-41981215 Length = 857 Score = 29.1 bits (62), Expect = 3.7 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -3 Query: 550 CLRKQLPKYLRFHAALRNLLPYCSKCYDLDQI 455 C KQLPK LR +LRNL Y C+ L+ + Sbjct: 583 CYLKQLPKDLRKMKSLRNL--YLDGCFRLENV 612 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,069,799 Number of Sequences: 37544 Number of extensions: 333499 Number of successful extensions: 638 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -