BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30140X (301 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF274347-1|AAF78084.1| 407|Homo sapiens PR-domain zinc finger p... 29 2.0 AK058065-1|BAB71647.1| 140|Homo sapiens protein ( Homo sapiens ... 28 6.2 >AF274347-1|AAF78084.1| 407|Homo sapiens PR-domain zinc finger protein 7 isoform A protein. Length = 407 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +1 Query: 229 HRKRQYKNYRCCNRKSKGR 285 +++RQY + RCCN K+KG+ Sbjct: 230 NQERQYSDPRCCNDKTKGQ 248 >AK058065-1|BAB71647.1| 140|Homo sapiens protein ( Homo sapiens cDNA FLJ25336 fis, clone TST00709. ). Length = 140 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +2 Query: 179 WLRSNWCSGVAKLTSGCIERGSTKITDVVIGNPKEGCP 292 WL ++W S GC E G ++T+ P G P Sbjct: 25 WLGADWISVPVVTLHGCPELGCVRLTEQWYTGPHTGLP 62 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,105,131 Number of Sequences: 237096 Number of extensions: 1121444 Number of successful extensions: 2580 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2580 length of database: 76,859,062 effective HSP length: 76 effective length of database: 58,839,766 effective search space used: 1353314618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -