BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30139X (492 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 1.8 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 5.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 5.4 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.0 bits (47), Expect = 1.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 17 RRGQRTLPLVRAFSQLGTCPDL*DGPSISASSA 115 +RG+ P V SQ G+ P PS + SSA Sbjct: 610 KRGKYEEPTVGEISQDGSSPHFHQSPSQNHSSA 642 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -3 Query: 130 EVQPSGAGCGYTWAILQIWTS 68 ++ P G GY +L WT+ Sbjct: 92 KIAPIFKGIGYATCVLSCWTN 112 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -3 Query: 130 EVQPSGAGCGYTWAILQIWTS 68 ++ P G GY +L WT+ Sbjct: 145 KIAPIFKGIGYATCVLSCWTN 165 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,524 Number of Sequences: 438 Number of extensions: 2529 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13544190 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -