BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30137X (571 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 27 0.57 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 27 0.57 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 27 0.57 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 27 0.57 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 27 0.57 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 27 0.57 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 27 0.57 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 27 0.57 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 27 0.57 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 27 0.57 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 27 0.57 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 27 0.57 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 26 0.75 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 25 1.3 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 24 3.0 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 23 5.3 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 7.0 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 7.0 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 9.3 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 9.3 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 23 9.3 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 142 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 170 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 118 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 146 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 26.6 bits (56), Expect = 0.57 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 110 VHGQYSLLDSDGHQRIVDYHADHHTGFNA 138 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 26.2 bits (55), Expect = 0.75 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 256 VRGSYSYTNTDGKPETITYFAD-ETGYHA 339 V G YS ++DG + Y AD TG++A Sbjct: 118 VHGQYSLLDSDGHHRIVDYHADHHTGFNA 146 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.4 bits (53), Expect = 1.3 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = -3 Query: 170 RNCSCKLHRGWRRIQTER 117 R C+ ++++ W+RI+TER Sbjct: 55 RTCNRQINQQWKRIRTER 72 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.2 bits (50), Expect = 3.0 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = +1 Query: 223 RRRQQASRYCCVRGSYSYTNTDGKPETITYFADETGYHAQGESIPQVASATS*TSKFP 396 +++QQ ++CC RGS+ E + + E H+ S Q A + +P Sbjct: 279 QQQQQHGQHCCCRGSHCGGGGGSDSEDLPQRSAEDRTHSPVGSQQQQEKAWDFSKAYP 336 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 23.4 bits (48), Expect = 5.3 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 215 PSAHQFRYARCRW 177 PS QFR+ C W Sbjct: 572 PSTEQFRFCNCGW 584 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 7.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 178 GSLEIVVVSSIGAGVEFRPNDLRVVLCRGGSDDGSHKGE 62 GS V+ + AG + + + + GGSDDGS G+ Sbjct: 961 GSNRTVIGRPVMAGDDMMMESVDLTI--GGSDDGSFAGD 997 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 7.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 178 GSLEIVVVSSIGAGVEFRPNDLRVVLCRGGSDDGSHKGE 62 GS V+ + AG + + + + GGSDDGS G+ Sbjct: 959 GSNRTVIGRPVMAGDDMMMESVDLTI--GGSDDGSFAGD 995 Score = 23.0 bits (47), Expect = 7.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 94 GGSDDGSHKGESYNDD 47 GG +DGS K E +DD Sbjct: 1722 GGEEDGSDKEEDDDDD 1737 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 323 RLDTMLRVNLFLRSPPPRAKLLN 391 +LD +L + FLR+ PP LLN Sbjct: 512 KLDLLL-LKAFLRNVPPNYNLLN 533 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -1 Query: 283 CSCNCSFHAHNNNVRLVVVVESLLQLTSFAT 191 CS + H+ NN L + ES LT T Sbjct: 157 CSAKIASHSSTNNSVLPYITESPTDLTDAPT 187 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 22.6 bits (46), Expect = 9.3 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -1 Query: 283 CSCNCSFHAHNNNVRLVVVVESLLQLTSFAT 191 CS + H+ NN L + ES LT T Sbjct: 158 CSAKIASHSSTNNSVLPYITESPTDLTDAPT 188 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,987 Number of Sequences: 2352 Number of extensions: 11645 Number of successful extensions: 75 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 53824896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -