BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30134X (536 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006631-5|AAF39790.3| 469|Caenorhabditis elegans Acetylcholine... 28 4.9 U97015-9|AAB52349.1| 343|Caenorhabditis elegans Hypothetical pr... 27 6.5 U58739-2|AAB00608.1| 391|Caenorhabditis elegans Hypothetical pr... 27 8.6 >AC006631-5|AAF39790.3| 469|Caenorhabditis elegans Acetylcholine receptor protein 21 protein. Length = 469 Score = 27.9 bits (59), Expect = 4.9 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +2 Query: 419 FRHTLHHNAVHGYPSNPVLPHSTVKTFSENLTV 517 F +HH VHGYP P L + S+ L V Sbjct: 290 FTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFV 322 >U97015-9|AAB52349.1| 343|Caenorhabditis elegans Hypothetical protein F48C1.8 protein. Length = 343 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 235 RRDHLNDWRIFPHFGYSERFM*VLDRQQHS*RFFSDCLP 351 RR + N + +P++GY+ R +D RF+ DC P Sbjct: 113 RRGYNNGYYGYPNYGYTCRVSQFVDYVGRVPRFYCDCPP 151 >U58739-2|AAB00608.1| 391|Caenorhabditis elegans Hypothetical protein F28C10.4 protein. Length = 391 Score = 27.1 bits (57), Expect = 8.6 Identities = 16/59 (27%), Positives = 32/59 (54%) Frame = -3 Query: 318 LLPVQYSHKTLRVSKMREYSPIVQVVSANSLNDRVIVLDLSSSEHLRILWIRKYSSCHT 142 LL + ++ +R+S R SPI+ ++ + + + VLDL++ IL + + + C T Sbjct: 141 LLGWEQTYPQIRISA-RYGSPIIDLLKLVDIKNGMFVLDLNTGLGENILEMPRIAKCQT 198 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,101,955 Number of Sequences: 27780 Number of extensions: 245308 Number of successful extensions: 750 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 750 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1070714938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -