BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30133 (608 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1970| Best HMM Match : DDOST_48kD (HMM E-Value=0) 88 6e-18 SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 29 2.9 SB_5014| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-07) 29 3.9 SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) 29 3.9 SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.0 SB_4525| Best HMM Match : Sugar_tr (HMM E-Value=0.028) 27 9.0 >SB_1970| Best HMM Match : DDOST_48kD (HMM E-Value=0) Length = 415 Score = 87.8 bits (208), Expect = 6e-18 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = +1 Query: 73 ADHETLVLIDNLNIKETHSQFFKSLQERGYGLTFKLADDANLVLSKYGEYLYKNLIVFAP 252 A TLVL+DN N KETHS FF SL+ +GY LTF+ ADDA+L L KYGE+LY NL++F+P Sbjct: 26 AGQRTLVLLDNANTKETHSIFFSSLKAKGYELTFRTADDASLALVKYGEFLYDNLVIFSP 85 Query: 253 S 255 S Sbjct: 86 S 86 Score = 85.4 bits (202), Expect = 3e-17 Identities = 42/97 (43%), Positives = 53/97 (54%) Frame = +3 Query: 255 VLEFGGQVDSEAITKFIDDXXXXXXXXXXXXXDVYREIASECGFEMDEESAAVIDHFNYD 434 V EFGG ++ AIT FID D RE+ SECG E DEE AVIDH ++D Sbjct: 87 VEEFGGSLNVRAITDFIDGGGNVLVAASSAIGDPLRELGSECGVEFDEEKTAVIDHISHD 146 Query: 435 VTDEGDHTRIVVSPKNLIKAPTIVGNRIHSLCYLKAL 545 V+D HT +V P N+IKA T+ G + S K + Sbjct: 147 VSDLDQHTLVVAEPSNVIKADTVTGKTVTSPLLFKGV 183 >SB_48704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 29.5 bits (63), Expect = 2.2 Identities = 21/89 (23%), Positives = 39/89 (43%) Frame = -1 Query: 470 YYNASVVSLISHIIVEVVYDCCRFLVHLKSTF*SDFSIYVSGRGVTSHKKVSAIVYEFGY 291 Y N + +++SH+ + DCC L +D +Y+ V + K F Y Sbjct: 860 YLNLIIKTMMSHLWASSL-DCCYILK-------ADDDVYIRVPSVIAWLKARRSHSRF-Y 910 Query: 290 GLTVYLSTKLEHEGANTMRFLYKYSPYFD 204 G +Y ++++ + + KY PYF+ Sbjct: 911 GGDIYTNSEISRDPCSPWGISKKYYPYFE 939 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 29.1 bits (62), Expect = 2.9 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +3 Query: 441 DEGDHTRIVVSPKNLIKAPTIVGNRIHSLC 530 D+GD V+SP++L+K+P + + + LC Sbjct: 632 DDGDDPMYVISPEDLLKSPDMCKSFLSFLC 661 >SB_5014| Best HMM Match : Galactosyl_T (HMM E-Value=1.5e-07) Length = 194 Score = 28.7 bits (61), Expect = 3.9 Identities = 21/89 (23%), Positives = 39/89 (43%) Frame = -1 Query: 470 YYNASVVSLISHIIVEVVYDCCRFLVHLKSTF*SDFSIYVSGRGVTSHKKVSAIVYEFGY 291 Y N + +++SH+ + DCC L +D +Y+ V + K F Y Sbjct: 10 YLNLIIKTMMSHLWASSL-DCCYILK-------ADDDVYIRVPRVIAWLKARRSHSRF-Y 60 Query: 290 GLTVYLSTKLEHEGANTMRFLYKYSPYFD 204 G +Y ++++ + + KY PYF+ Sbjct: 61 GGDIYTNSEISRDPCSPWGISKKYYPYFE 89 >SB_14918| Best HMM Match : Extensin_2 (HMM E-Value=0.35) Length = 1242 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 412 TAADSSSISNPHSEAISLYTSPAAALP 332 TA S+I++PH+ +S T+PAA P Sbjct: 476 TAQTRSAITSPHAYTVSSVTAPAATSP 502 >SB_50768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1069 Score = 27.5 bits (58), Expect = 9.0 Identities = 22/66 (33%), Positives = 32/66 (48%) Frame = -2 Query: 451 SPSSVTS*LKWSMTAADSSSISNPHSEAISLYTSPAAALPAIRRFPPSSMNLVMASLSTC 272 SP+S TS +K S ++ S+ P + S S + LP P++ N +SLST Sbjct: 107 SPASPTS-IKQSPNSSSSTG-QTPTEKTDSTPKSSGSTLPTSST--PATQNPTDSSLSTK 162 Query: 271 PPNSST 254 PP T Sbjct: 163 PPTKKT 168 >SB_4525| Best HMM Match : Sugar_tr (HMM E-Value=0.028) Length = 630 Score = 27.5 bits (58), Expect = 9.0 Identities = 13/72 (18%), Positives = 34/72 (47%) Frame = -1 Query: 464 NASVVSLISHIIVEVVYDCCRFLVHLKSTF*SDFSIYVSGRGVTSHKKVSAIVYEFGYGL 285 +A + +++++ E ++ + D+S+ G+ +T HK+ A EF G+ Sbjct: 550 SAIIAGAMTYLLPETLFAKMHQTIEQTEAAEDDYSVVCCGKPLTRHKQTKAQAVEFKDGV 609 Query: 284 TVYLSTKLEHEG 249 + ++++G Sbjct: 610 VLTNFETVQNKG 621 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,369,327 Number of Sequences: 59808 Number of extensions: 349837 Number of successful extensions: 870 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 811 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -