BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30133 (608 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 27 0.36 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 24 4.4 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 27.5 bits (58), Expect = 0.36 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -2 Query: 418 SMTAADSSSISNPHSEAISLYTSPAAAL-PAIRRFPPSSMNLVMASLSTCPPNSST 254 S + A +S+ H+E T P AAL PA P ++ NL + PNSST Sbjct: 22 STSPAAMASLVLDHTELPLAGTIPPAALMPARVLLPSNATNLTLTLEELLRPNSST 77 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.8 bits (49), Expect = 4.4 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -1 Query: 407 CRFLVHLKSTF*SDFSIYVSGRGVTSHKKVSAIVYEFGYGLT 282 C FL+ + S S+ G S + SAIVY Y LT Sbjct: 78 CAFLLLVLYISSSPSSLLSDGPRTNSFLRTSAIVYNHTYPLT 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,781 Number of Sequences: 2352 Number of extensions: 11347 Number of successful extensions: 23 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -