BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30132 (735 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC101552-1|AAI01553.1| 275|Homo sapiens hypothetical protein LO... 30 7.5 BC101550-1|AAI01551.1| 275|Homo sapiens family with sequence si... 30 7.5 AK125682-1|BAC86245.1| 275|Homo sapiens protein ( Homo sapiens ... 30 7.5 AK123232-1|BAC85565.1| 275|Homo sapiens protein ( Homo sapiens ... 30 7.5 >BC101552-1|AAI01553.1| 275|Homo sapiens hypothetical protein LOC285386 protein. Length = 275 Score = 30.3 bits (65), Expect = 7.5 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 547 RNIISIKWSFIETFSVDFWRIPRSYVQRLC---FIFPHLCTFTDTKQLINHRYYTFTPEE 717 + ++ K+ FI V RIP S V R+C F FP + D +Q R Y +PEE Sbjct: 118 KTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMS--LDKRQGEGLRIYWGSPEE 175 >BC101550-1|AAI01551.1| 275|Homo sapiens family with sequence similarity 79, member B protein. Length = 275 Score = 30.3 bits (65), Expect = 7.5 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 547 RNIISIKWSFIETFSVDFWRIPRSYVQRLC---FIFPHLCTFTDTKQLINHRYYTFTPEE 717 + ++ K+ FI V RIP S V R+C F FP + D +Q R Y +PEE Sbjct: 118 KTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMS--LDKRQGEGLRIYWGSPEE 175 >AK125682-1|BAC86245.1| 275|Homo sapiens protein ( Homo sapiens cDNA FLJ43694 fis, clone TBAES2006568. ). Length = 275 Score = 30.3 bits (65), Expect = 7.5 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 547 RNIISIKWSFIETFSVDFWRIPRSYVQRLC---FIFPHLCTFTDTKQLINHRYYTFTPEE 717 + ++ K+ FI V RIP S V R+C F FP + D +Q R Y +PEE Sbjct: 118 KTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMS--LDKRQGEGLRIYWGSPEE 175 >AK123232-1|BAC85565.1| 275|Homo sapiens protein ( Homo sapiens cDNA FLJ41238 fis, clone BRAMY2032014. ). Length = 275 Score = 30.3 bits (65), Expect = 7.5 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +1 Query: 547 RNIISIKWSFIETFSVDFWRIPRSYVQRLC---FIFPHLCTFTDTKQLINHRYYTFTPEE 717 + ++ K+ FI V RIP S V R+C F FP + D +Q R Y +PEE Sbjct: 118 KTLLICKYDFIMLSCVQLQRIPLSAVYRICLGKFTFPGMS--LDKRQGEGLRIYWGSPEE 175 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,978,772 Number of Sequences: 237096 Number of extensions: 1538886 Number of successful extensions: 3343 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3343 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -