BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30131 (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 33 0.002 M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosec... 23 3.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 4.1 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 22 7.2 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.5 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 33.5 bits (73), Expect = 0.002 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = -2 Query: 472 KDTPGFVVNRLLVPYICEAIRLYERGDASARDIDIAMKLGAG 347 ++ GFV+NR+ + EA RL G +A+D+D M G G Sbjct: 3 REIDGFVLNRIQYAILNEAWRLVADGILNAKDVDAVMSEGLG 44 >M12598-1|AAA27733.1| 77|Apis mellifera protein ( Bee preprosecapin mRNA, complete cds. ). Length = 77 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 457 FVVNRLLVPYICEAIRLYERGDASARDIDI 368 FVV L++P CEA+ +R AR D+ Sbjct: 19 FVVILLIIPSKCEAVS-NDRQSLEARSADL 47 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 4.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 747 IVENIGVKHKLFKQLDGVAPSHTIFASNTSSLSIT 643 +V G KH + VA S+ +SN+ SLS+T Sbjct: 22 VVSVAGYKHSRRHRDFTVAESYDASSSNSDSLSMT 56 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 21.8 bits (44), Expect = 7.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 370 IAMKLGAGYPMGPLELAD 317 +A +LG+G PMG L D Sbjct: 2 LAFQLGSGTPMGAKYLMD 19 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 399 LSYNLMASHM*GTNSLFTTKPGVSL 473 L Y L+++ + G N+LFT PG L Sbjct: 48 LEYFLLSAFLFGANALFT--PGQEL 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,587 Number of Sequences: 438 Number of extensions: 5239 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -