BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30127 (731 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1782.02c |||conserved fungal protein|Schizosaccharomyces pom... 29 0.90 SPAC25B8.01 |dap1|SPAC26H5.15|cytochrome P450 regulator Dap1|Sch... 27 3.6 SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces ... 26 4.8 >SPAC1782.02c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 161 Score = 28.7 bits (61), Expect = 0.90 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -2 Query: 613 FLSQSVLFCILLLQNNVDFTSARGPVRLIFFFLWWDF 503 FL +++ I LLQ+N F S P+R IF F+ F Sbjct: 65 FLILGMIYTISLLQSNFLFFSGITPIRAIFDFILTGF 101 >SPAC25B8.01 |dap1|SPAC26H5.15|cytochrome P450 regulator Dap1|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 26.6 bits (56), Expect = 3.6 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = +3 Query: 297 IFV*LDITPWRRTNKKNVIAS 359 +F+ L IT WRR N+K+ IAS Sbjct: 12 LFLYLLITRWRRKNEKSFIAS 32 >SPBC3E7.05c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 270 PRPLL*SIVETPKEIPQRSRDKSPWRQIF*DHE 172 P L+ IV+ P E+ + + ++S W+ I D E Sbjct: 163 PESLVVEIVDLPSEVTKDTAEESVWKDIGLDQE 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,776,017 Number of Sequences: 5004 Number of extensions: 54606 Number of successful extensions: 112 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -