BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30127 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10819| Best HMM Match : DCX (HMM E-Value=6.3e-19) 31 1.3 SB_5767| Best HMM Match : Gal_Lectin (HMM E-Value=7.4e-08) 28 6.8 >SB_10819| Best HMM Match : DCX (HMM E-Value=6.3e-19) Length = 1199 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = +1 Query: 202 TLIS-GSLWDFFWRLHNTSKQRSGNFFNYY--PKIFLCNLILPHGE 330 T++S G +FWR HN +R +F Y P+ C P+G+ Sbjct: 492 TIVSCGKEHIYFWRWHNGKLERKNGYFEKYPVPQYLTCMDFAPNGD 537 >SB_5767| Best HMM Match : Gal_Lectin (HMM E-Value=7.4e-08) Length = 504 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 271 SPTAALKYCGDAKRNPTTIP 212 +PT L+YCGDA TT P Sbjct: 94 TPTCRLRYCGDAPALTTTAP 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,635,223 Number of Sequences: 59808 Number of extensions: 364559 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -