BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30125 (712 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 22 5.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 5.7 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 9.9 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 108 RGTCLPAPVSLKKVLKES 55 RGTC P LKK L ++ Sbjct: 53 RGTCSPDGEELKKALPDA 70 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 561 YGGRCHRWLHC 529 Y G C R+LHC Sbjct: 1287 YPGDCTRYLHC 1297 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 534 EAIYDICRRNLDIERPTYTNLNRLIGQIV 620 E I DIC R+ D ++NR+ G I+ Sbjct: 510 EQIVDICIRSHDKLCDVCDSVNRIFGFII 538 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/33 (21%), Positives = 18/33 (54%) Frame = +3 Query: 552 CRRNLDIERPTYTNLNRLIGQIVSSITASLRFD 650 C + RPT+T L++ + ++ ++ L+ + Sbjct: 730 CWKECPKNRPTFTELSKSLEGLLENVAQYLQIE 762 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,799 Number of Sequences: 336 Number of extensions: 3484 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -