BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30119 (505 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) 110 7e-25 SB_35727| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.1e-07) 72 2e-13 SB_44699| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_32312| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_5679| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_6626| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) 69 2e-12 SB_41736| Best HMM Match : Ribosomal_L24e (HMM E-Value=3.2e-07) 67 9e-12 SB_49067| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.8e-07) 66 2e-11 SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 >SB_24372| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.5e-40) Length = 154 Score = 110 bits (264), Expect = 7e-25 Identities = 48/65 (73%), Positives = 53/65 (81%) Frame = +2 Query: 2 KIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKK 181 K+ LC YSGYKIYPGHGK V+ DGK F FLN +CE A LMRRNPR+VTWTVLYRRK KK Sbjct: 2 KLELCNYSGYKIYPGHGKRYVRQDGKVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKK 61 Query: 182 GQEEE 196 G +EE Sbjct: 62 GTQEE 66 >SB_35727| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.1e-07) Length = 139 Score = 72.1 bits (169), Expect = 2e-13 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +2 Query: 65 KVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 196 K GK F +LN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 38 KFQGKVFNYLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 81 >SB_44699| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 113 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 77 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 196 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 >SB_32312| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 77 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 196 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 >SB_5679| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 77 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 196 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 >SB_6626| Best HMM Match : Ribosomal_L24e (HMM E-Value=2.2e-07) Length = 90 Score = 69.3 bits (162), Expect = 2e-12 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 77 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 196 K F FLN +CE A LMRRNPR+VTWTVLYRRK KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRKHKKGTQEE 46 >SB_41736| Best HMM Match : Ribosomal_L24e (HMM E-Value=3.2e-07) Length = 104 Score = 66.9 bits (156), Expect = 9e-12 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 77 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 196 K F FLN +CE A LMRRNPR+VTWTVLYRR KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRRMHKKGTQEE 46 >SB_49067| Best HMM Match : Ribosomal_L24e (HMM E-Value=8.8e-07) Length = 90 Score = 66.1 bits (154), Expect = 2e-11 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 77 KTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE 196 K F FLN +CE A LMRRNPR+VTWTVLYR K KKG +EE Sbjct: 7 KVFNFLNKRCERALLMRRNPREVTWTVLYRCKHKKGTQEE 46 >SB_14467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 27.5 bits (58), Expect = 6.6 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 122 MRRNPRKVTWTVLYRR 169 M+RNPRK+ WT +R+ Sbjct: 1 MKRNPRKMKWTKAFRK 16 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,847,176 Number of Sequences: 59808 Number of extensions: 213842 Number of successful extensions: 468 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -