BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30119 (505 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003151-13|AAK18907.1| 159|Caenorhabditis elegans Ribosomal pr... 81 4e-16 Z75525-5|CAA99764.1| 162|Caenorhabditis elegans Hypothetical pr... 47 7e-06 Z46267-15|CAI79255.1| 1100|Caenorhabditis elegans Hypothetical p... 30 1.1 Z46267-12|CAD45595.2| 528|Caenorhabditis elegans Hypothetical p... 30 1.1 Z46267-11|CAA86426.1| 611|Caenorhabditis elegans Hypothetical p... 30 1.1 U80030-10|AAG24167.2| 378|Caenorhabditis elegans Serpentine rec... 28 4.4 >AF003151-13|AAK18907.1| 159|Caenorhabditis elegans Ribosomal protein, large subunitprotein 24.1 protein. Length = 159 Score = 81.0 bits (191), Expect = 4e-16 Identities = 35/61 (57%), Positives = 42/61 (68%) Frame = +2 Query: 2 KIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKK 181 K+ C YSGYKI+PGHGK +V+ DGK FL+ K +RRNPR + WTVLYR K KK Sbjct: 2 KVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNKK 61 Query: 182 G 184 G Sbjct: 62 G 62 >Z75525-5|CAA99764.1| 162|Caenorhabditis elegans Hypothetical protein C03D6.8 protein. Length = 162 Score = 47.2 bits (107), Expect = 7e-06 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +2 Query: 2 KIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRR 169 +I C + IYPGHG V+ D F F S+C ++NPRK+ +T RR Sbjct: 2 RIEKCYFCSSPIYPGHGIQFVRNDSTVFKFCRSRCNKLFKKKKNPRKLRFTKAARR 57 >Z46267-15|CAI79255.1| 1100|Caenorhabditis elegans Hypothetical protein F49E2.5j protein. Length = 1100 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 157 PVQAQVQKGPRGRTSKETY*KDPKVPTCDCWCLLSDIMAKRNMKPE 294 PVQ QV++ + + SK+T + K PT D D + + KPE Sbjct: 543 PVQEQVKEQKKSKKSKKTSESESKRPTADDSMDFLDFVTAKPEKPE 588 >Z46267-12|CAD45595.2| 528|Caenorhabditis elegans Hypothetical protein F49E2.5g protein. Length = 528 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 157 PVQAQVQKGPRGRTSKETY*KDPKVPTCDCWCLLSDIMAKRNMKPE 294 PVQ QV++ + + SK+T + K PT D D + + KPE Sbjct: 460 PVQEQVKEQKKSKKSKKTSESESKRPTADDSMDFLDFVTAKPEKPE 505 >Z46267-11|CAA86426.1| 611|Caenorhabditis elegans Hypothetical protein F49E2.5f protein. Length = 611 Score = 29.9 bits (64), Expect = 1.1 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 157 PVQAQVQKGPRGRTSKETY*KDPKVPTCDCWCLLSDIMAKRNMKPE 294 PVQ QV++ + + SK+T + K PT D D + + KPE Sbjct: 543 PVQEQVKEQKKSKKSKKTSESESKRPTADDSMDFLDFVTAKPEKPE 588 >U80030-10|AAG24167.2| 378|Caenorhabditis elegans Serpentine receptor, class w protein136 protein. Length = 378 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 8/66 (12%) Frame = -2 Query: 318 LFSLRFTYFRLHITLSHNVTK*APTIARWNFWVLLV--------RFFACSSSWPFLNLRL 163 +F + F+ +SH + +P + R+++W+ L+ F S+W FL++ Sbjct: 77 IFDILTFLFQFKQIISHFIHASSPCLGRFSYWITLIDKSGFVIKDFSRRCSTWLFLSIAF 136 Query: 162 YRTVHV 145 RT+ V Sbjct: 137 IRTLIV 142 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,784,347 Number of Sequences: 27780 Number of extensions: 163252 Number of successful extensions: 305 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 304 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 305 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 967231538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -