BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30118 (793 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.13c |cid14||poly|Schizosaccharomyces pombe|chr 1|||Manual 27 3.1 SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch... 27 3.1 >SPAC12G12.13c |cid14||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 684 Score = 27.1 bits (57), Expect = 3.1 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -2 Query: 558 KKHCRTEPPGFVVYKNELPSPFSFSNQSRKSVKADISDFVL 436 +K+ RTEP ++KN+ PS F S + K +D D +L Sbjct: 16 RKNERTEPLPRRIFKNDKPSKFK-SKRKEKDKNSDAYDEML 55 >SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosaccharomyces pombe|chr 2|||Manual Length = 2352 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +2 Query: 269 IDEICQIAAYTPKQTYSQYIMPYGDLNPGARRRHNVRVVTVG 394 +D Q+ + + ++ + I DL P HNV+++T+G Sbjct: 1460 VDPSAQLLVFVGRWSHQKGIDLIADLAPKLLTEHNVQLITIG 1501 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,170,735 Number of Sequences: 5004 Number of extensions: 62443 Number of successful extensions: 168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -