BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30118 (793 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0366 - 22389591-22390527,22391296-22391429,22391762-223918... 33 0.26 04_01_0288 + 3824337-3826385 29 3.2 09_06_0311 + 22218219-22218421,22219157-22219422,22219881-222200... 29 4.2 01_06_1373 - 36729498-36729950,36730024-36730306,36730592-36730605 29 4.2 12_02_1233 + 27224219-27225607 29 5.6 11_06_0726 - 26707605-26708036 28 7.4 03_01_0228 + 1802038-1803265,1804207-1804245,1804638-1804783,180... 28 9.8 >02_04_0366 - 22389591-22390527,22391296-22391429,22391762-22391816, 22392364-22393225,22393342-22393459,22393647-22393737, 22394627-22394670 Length = 746 Score = 33.1 bits (72), Expect = 0.26 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 3/72 (4%) Frame = -1 Query: 292 CYLTYLIY*SPSCVSISQPIR---EYFPGGRPTGFSASAGGTSVFASISLPFTFTSVTMA 122 C L + +Y + S+ Q R PG P GF+ AG SVF +S+ FTS+ Sbjct: 484 CILFWTVYSQMTTFSVEQATRMDRHLRPGAAPGGFAIPAGSLSVFLFLSI-LLFTSLNER 542 Query: 121 INA*FANSLMNR 86 + A L R Sbjct: 543 VLVPAARRLTRR 554 >04_01_0288 + 3824337-3826385 Length = 682 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 398 YRMLKDMVSHKILKTKSEISALTDFLDWLEKE 493 +++ K SH KT +++S L F DWL+ + Sbjct: 395 HKITKATTSHHWFKTLNDLSTLVGFADWLDMQ 426 >09_06_0311 + 22218219-22218421,22219157-22219422,22219881-22220050, 22220149-22220365,22220798-22221021,22221559-22221738, 22221875-22222013,22222107-22222255,22223394-22223505, 22223998-22224506,22224661-22224784,22224904-22225178, 22225507-22225626,22225707-22225769,22225861-22226052, 22226381-22226440,22226535-22226738,22226926-22227051, 22227093-22227254,22227357-22227476,22227665-22227820, 22227895-22227957,22228041-22228168,22228524-22228920, 22229442-22229544,22229646-22229776,22230096-22230167, 22230472-22230553,22231083-22231190,22231288-22231429, 22231659-22231698,22231746-22231876,22232215-22232301, 22232395-22232605,22232687-22232741,22232836-22232927, 22233011-22233071,22233361-22233719 Length = 2010 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 251 YTGRRLIDEICQIAAYTPKQTYSQYIMPYGDLNPGA 358 Y+G+R++ ++ ++ Y P Q + +YI L PGA Sbjct: 1131 YSGQRVLSQVVKVEVYKPLQIHPEYIY----LTPGA 1162 >01_06_1373 - 36729498-36729950,36730024-36730306,36730592-36730605 Length = 249 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 461 LTDFLDWLEKEKGDGSSF 514 L DF DW+EKEK +G F Sbjct: 129 LEDFEDWIEKEKNEGMFF 146 >12_02_1233 + 27224219-27225607 Length = 462 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 269 IDEICQIAAYTPKQTYSQYIMPYGDLNPGARRRHNVRVVTVG-RYRMLK 412 IDE+C + + P TYS Y G L + +R+ RYR++K Sbjct: 209 IDEVCSSSGWEPFDTYSVYFR--GSLYVHCQNNCVIRITIANHRYRIIK 255 >11_06_0726 - 26707605-26708036 Length = 143 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 672 AASVGSCATGRGLSVSGQRHRTGNSCL*DCQHLAQGEQQE 791 A +GSCA + +G+ + TG++ C +AQ E+++ Sbjct: 51 ATILGSCAAASAFATTGEANATGSAPAARCLSVAQQEREK 90 >03_01_0228 + 1802038-1803265,1804207-1804245,1804638-1804783, 1804891-1804958,1805045-1805147,1805287-1805400 Length = 565 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +2 Query: 341 DLNPGARRRHNVRVVTVGRYRMLKDMVSHKILKTKSEISALT 466 +L P R H++RVV + R+ D +I+ T EISA T Sbjct: 145 ELLPKLPRAHDLRVVLLESARLPGDSSDPRIVATIEEISATT 186 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,680,413 Number of Sequences: 37544 Number of extensions: 420054 Number of successful extensions: 1163 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -