BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30110X (610 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3E7.16c |leu3|SPBC4F6.03c|2-isopropylmalate synthase|Schizos... 25 8.7 SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|ch... 25 8.7 SPBP19A11.01 |||glycine decarboxylase complex subunit H|Schizosa... 25 8.7 >SPBC3E7.16c |leu3|SPBC4F6.03c|2-isopropylmalate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 584 Score = 25.0 bits (52), Expect = 8.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +2 Query: 197 EPETLIDVSDAASGATRPAPAQP 265 EP+ ++V +A G +P+ AQP Sbjct: 201 EPDFALEVCEAVKGMWKPSAAQP 223 >SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 219 Score = 25.0 bits (52), Expect = 8.7 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 2/31 (6%) Frame = -2 Query: 252 AGRVAPLAASD--TSISVSGSQPAEHTTCPN 166 + R A AA++ +S S++G++PA T+ PN Sbjct: 153 SSRAAQSAAAELISSSSITGARPANSTSVPN 183 >SPBP19A11.01 |||glycine decarboxylase complex subunit H|Schizosaccharomyces pombe|chr 2|||Manual Length = 169 Score = 25.0 bits (52), Expect = 8.7 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +2 Query: 146 TDQQIERLGHVVCSAGWEPETLIDVSDAASGATRPAPAQPCGAPRSGT 289 T LG VV EPET + V D A +P SGT Sbjct: 66 TSYAANALGEVVFVELPEPETTVSVGDGIGAVESVKSASDVYSPVSGT 113 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,530,973 Number of Sequences: 5004 Number of extensions: 22588 Number of successful extensions: 53 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -