BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30106 (762 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 22 5.4 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 7.1 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 22.2 bits (45), Expect = 5.4 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +3 Query: 642 RVLGDVDCLPFGLQDRAGISAVALLTRVLDAAAHAMS 752 RV +VD LPFG+++ IS+V R L+ + + S Sbjct: 37 RVAEEVDPLPFGVENT--ISSVPQPPRSLEGSYDSSS 71 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 739 AAASKTRVKSATALIPARSCRPNGKQSTSPKTRH 638 AA+ T + ++ +L C P + S KTRH Sbjct: 791 AASFHTDIGNSQSLAHQDQCCPGFTMTKSGKTRH 824 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,055 Number of Sequences: 438 Number of extensions: 3622 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -