BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30102 (734 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 28 6.8 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 9.0 >SB_2588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1068 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/39 (38%), Positives = 26/39 (66%) Frame = +1 Query: 256 IWN*NAFKFLINLGTRARTDLSNMKFLVLALCVCAVSAQ 372 ++N + FKF++NL T R+ +SN K ++ A+C +S Q Sbjct: 463 VYNTDYFKFILNLATCNRSFVSN-KQVLFAVCSLQLSIQ 500 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 14 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 133 C ++H G+++ I + R Q+ G+ R C TS+ ++ Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 26 WHWGSVDSISGSRARFQLSGNSGRKHSR 109 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,969,632 Number of Sequences: 59808 Number of extensions: 427568 Number of successful extensions: 938 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1974037988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -