BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30102 (734 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical... 31 1.1 AF043704-2|AAX88816.1| 407|Caenorhabditis elegans Prion-like-(q... 29 3.4 >AL021487-10|CAA16357.2| 1592|Caenorhabditis elegans Hypothetical protein Y45F10B.10 protein. Length = 1592 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/51 (37%), Positives = 25/51 (49%) Frame = -1 Query: 182 YHGSSSQL*HNAAGH*ISVVCLCSSGCASCRYSR*AETEHGSH*WSQQTPS 30 YH +S QL GH +V CLCSS +S S + +SQ TP+ Sbjct: 896 YHIASEQLIGTFKGHTAAVTCLCSSNDSSLFVSTSFDKTVNVWVFSQSTPT 946 >AF043704-2|AAX88816.1| 407|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 72 protein. Length = 407 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/63 (31%), Positives = 32/63 (50%) Frame = +3 Query: 543 TDNGISAQSSGSLKKVDNIDVLAIQGQYEYSAPDGTPVKFTYTADENGYQPQSELLPVAP 722 T G+ A + LKKVD+I+ +Q E S+P+ P T+ + +P + P +P Sbjct: 116 TTEGLQADN---LKKVDDIEAAILQAVIESSSPE-PPRSSTHRQRIHRIRPGHRIRP-SP 170 Query: 723 PMP 731 P P Sbjct: 171 PAP 173 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,003,960 Number of Sequences: 27780 Number of extensions: 314743 Number of successful extensions: 747 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -