BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30101 (807 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC644.05c |||deoxyuridine 5'-triphosphate nucleotidohydrolase ... 113 3e-26 SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2... 30 0.44 SPBC18H10.02 |lcf1||long-chain-fatty-acid-CoA ligase Lcf1 |Schiz... 27 4.1 SPBC530.13 |||cyclin Ctk2|Schizosaccharomyces pombe|chr 2|||Manual 26 7.2 >SPAC644.05c |||deoxyuridine 5'-triphosphate nucleotidohydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 140 Score = 113 bits (272), Expect = 3e-26 Identities = 56/84 (66%), Positives = 64/84 (76%) Frame = +1 Query: 511 YGRVAPRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRIAQLICEKIY 690 YGRVAPRSGLA K+ ID GAGVID DYRG+V V+LFN+SD DF +K GDRIAQLI E+I Sbjct: 56 YGRVAPRSGLASKHSIDTGAGVIDADYRGHVRVLLFNYSDVDFPIKVGDRIAQLILERIV 115 Query: 691 YPVLQEVANLSVTQRGDGGFGSTG 762 P + V +L T RG GFGSTG Sbjct: 116 NPPVILVESLEATVRGANGFGSTG 139 Score = 50.0 bits (114), Expect = 4e-07 Identities = 25/48 (52%), Positives = 31/48 (64%) Frame = +2 Query: 365 RLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPG 508 +LSE A P +GS +AG DL +A + VP RGK LV TDL I +P G Sbjct: 7 KLSEKATIPTKGSANSAGYDLYAAAECIVPRRGKVLVDTDLAIAVPEG 54 >SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 411 Score = 29.9 bits (64), Expect = 0.44 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 193 CFDFKCLHLHNLI*DYHKLTFSNFIFDIKRILALEI 300 C D C HLH+L D H L S F + +++ E+ Sbjct: 289 CLDVDCQHLHSL--DTHSLDISTHTFKLPPLMSKEV 322 >SPBC18H10.02 |lcf1||long-chain-fatty-acid-CoA ligase Lcf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 26.6 bits (56), Expect = 4.1 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 761 PVEPNPPSPL*VTDKLATSCNTG 693 PVEP+PPSP + + TS +TG Sbjct: 230 PVEPDPPSPEEICCIMYTSGSTG 252 >SPBC530.13 |||cyclin Ctk2|Schizosaccharomyces pombe|chr 2|||Manual Length = 325 Score = 25.8 bits (54), Expect = 7.2 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 166 LSNITYYRFCFDFKCLHLHNLI*DYHK-LTFSN 261 L +T CFDF+ H HN + + K L FS+ Sbjct: 129 LERMTLELICFDFRVRHPHNYMVKFAKSLKFSS 161 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,721,455 Number of Sequences: 5004 Number of extensions: 50381 Number of successful extensions: 112 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 392429240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -