BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30101 (807 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46940.1 68416.m05095 deoxyuridine 5'-triphosphate nucleotido... 126 1e-29 >At3g46940.1 68416.m05095 deoxyuridine 5'-triphosphate nucleotidohydrolase family contains Pfam profile: PF00692 deoxyuridine 5'-triphosphate nucleotidohydrolase Length = 166 Score = 126 bits (305), Expect = 1e-29 Identities = 62/84 (73%), Positives = 67/84 (79%) Frame = +1 Query: 511 YGRVAPRSGLALKNFIDVGAGVIDEDYRGNVGVVLFNHSDTDFSVKKGDRIAQLICEKIY 690 Y R+APRSGLA K+ IDVGAGVID DYRG VGV+LFNHSD DF VK GDRIAQLI EKI Sbjct: 82 YARIAPRSGLAWKHSIDVGAGVIDADYRGPVGVILFNHSDADFEVKFGDRIAQLIIEKIV 141 Query: 691 YPVLQEVANLSVTQRGDGGFGSTG 762 P + EV +L T RGDGGFGSTG Sbjct: 142 TPDVVEVDDLDETVRGDGGFGSTG 165 Score = 60.5 bits (140), Expect = 1e-09 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = +2 Query: 347 PILKFTRLSENAFQPVRGSEKAAGIDLMSAYDYTVPARGKELVKTDLQIELPPG 508 P K +LSE A P RGS +AG DL SA D VPARGK L+ TDL I +P G Sbjct: 27 PFFKVKKLSEKAVIPTRGSPLSAGYDLSSAVDSKVPARGKALIPTDLSIAVPEG 80 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,676,173 Number of Sequences: 28952 Number of extensions: 247951 Number of successful extensions: 534 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1833827200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -