BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30094 (288 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value J04982-1|AAA51736.1| 298|Homo sapiens ANT1 protein. 73 2e-13 J02966-1|AAA61223.1| 297|Homo sapiens ANT1 protein. 73 2e-13 BC063643-1|AAH63643.1| 298|Homo sapiens solute carrier family 2... 73 2e-13 BC061589-1|AAH61589.1| 298|Homo sapiens solute carrier family 2... 73 2e-13 BC008664-1|AAH08664.1| 298|Homo sapiens solute carrier family 2... 73 2e-13 M57424-1|AAA51737.1| 298|Homo sapiens adenine nucleotide transl... 71 7e-13 L78810-1|AAB39266.1| 298|Homo sapiens ANT-2 protein. 71 7e-13 J03591-1|AAA36749.1| 252|Homo sapiens protein ( Human ADP/ATP t... 71 7e-13 J02683-1|AAA35579.1| 298|Homo sapiens protein ( Human ADP/ATP c... 71 7e-13 BC068199-1|AAH68199.1| 323|Homo sapiens SLC25A5 protein protein. 71 7e-13 BC056160-1|AAH56160.1| 298|Homo sapiens solute carrier family 2... 71 7e-13 AC004000-1|AAB96347.1| 298|Homo sapiens ADP/ATP carrier protein... 71 7e-13 J03592-1|AAA36750.1| 262|Homo sapiens protein ( Human ADP/ATP t... 70 1e-12 CR457400-1|CAG33681.1| 298|Homo sapiens SLC25A6 protein. 70 1e-12 BC031912-1|AAH31912.1| 298|Homo sapiens solute carrier family 2... 70 1e-12 BC014775-1|AAH14775.1| 298|Homo sapiens solute carrier family 2... 70 1e-12 BC008935-1|AAH08935.1| 298|Homo sapiens solute carrier family 2... 70 1e-12 BC008737-1|AAH08737.1| 298|Homo sapiens solute carrier family 2... 70 1e-12 BC007850-1|AAH07850.1| 298|Homo sapiens solute carrier family 2... 70 1e-12 BC007295-1|AAH07295.1| 298|Homo sapiens solute carrier family 2... 70 1e-12 AY007135-1|AAG01998.1| 298|Homo sapiens protein ( Homo sapiens ... 70 1e-12 AL683870-1|CAI39843.1| 298|Homo sapiens solute carrier family 2... 70 1e-12 AB209822-1|BAD93059.1| 323|Homo sapiens ADP,ATP carrier protein... 70 1e-12 BC022032-1|AAH22032.1| 315|Homo sapiens solute carrier family 2... 62 2e-10 AY550240-1|AAT42263.1| 315|Homo sapiens sperm flagellar energy ... 62 2e-10 AJ863129-1|CAI05952.1| 315|Homo sapiens ADP/ATP carrier isoform... 62 2e-10 AC093591-1|AAY40974.1| 315|Homo sapiens unknown protein. 62 2e-10 X96924-1|CAA65633.1| 318|Homo sapiens mitochondrial citrate tra... 32 0.29 U25147-1|AAB08515.1| 311|Homo sapiens citrate transporter prote... 32 0.29 L76134-1|AAL40091.1| 311|Homo sapiens citrate transport protein... 32 0.29 L75823-1|AAL40090.1| 311|Homo sapiens citrate transport protein... 32 0.29 BC008061-1|AAH08061.1| 311|Homo sapiens solute carrier family 2... 32 0.29 BC004980-1|AAH04980.1| 311|Homo sapiens solute carrier family 2... 32 0.29 BC113365-1|AAI13366.1| 299|Homo sapiens solute carrier family 2... 32 0.39 BC101521-1|AAI01522.1| 299|Homo sapiens solute carrier family 2... 32 0.39 AJ278148-1|CAC27562.1| 299|Homo sapiens oxodicarboxylate carrie... 32 0.39 AL358817-5|CAI13858.1| 1223|Homo sapiens ADAM metallopeptidase w... 28 4.8 AL358817-4|CAI13857.1| 1226|Homo sapiens ADAM metallopeptidase w... 28 4.8 AL355344-5|CAI41277.1| 1223|Homo sapiens ADAM metallopeptidase w... 28 4.8 AL355344-4|CAI41278.1| 1226|Homo sapiens ADAM metallopeptidase w... 28 4.8 AJ345098-1|CAC87943.1| 1223|Homo sapiens metalloprotease-disinte... 28 4.8 AF366351-1|AAL79814.1| 1159|Homo sapiens ADAMTS14 protein. 28 4.8 AF358666-1|AAL40229.1| 1223|Homo sapiens a disintegrin-like and ... 28 4.8 BC016932-1|AAH16932.1| 678|Homo sapiens solute carrier family 2... 28 6.3 AJ496568-1|CAD43090.1| 678|Homo sapiens mitochondrial aspartate... 28 6.3 AC068039-2|AAY24134.1| 678|Homo sapiens unknown protein. 28 6.3 Y14494-1|CAA74834.1| 678|Homo sapiens aralar1 protein. 27 8.3 U84763-1|AAC51367.1| 312|Homo sapiens UCP3 protein. 27 8.3 U82818-1|AAC51356.1| 275|Homo sapiens UCP3S protein. 27 8.3 BC132735-1|AAI32736.1| 1205|Homo sapiens ADAMTS3 protein protein. 27 8.3 BC130287-1|AAI30288.1| 1205|Homo sapiens ADAM metallopeptidase w... 27 8.3 AK074120-1|BAB84946.1| 1437|Homo sapiens FLJ00192 protein protein. 27 8.3 AJ003125-1|CAA05880.1| 1211|Homo sapiens procollagen I N-protein... 27 8.3 AF509504-1|AAM88322.1| 1537|Homo sapiens DOT1-like protein protein. 27 8.3 AF050113-1|AAG02284.1| 312|Homo sapiens uncoupling protein-3 pr... 27 8.3 AF012202-1|AAC51785.1| 300|Homo sapiens uncoupling protein 3 pr... 27 8.3 AF011449-1|AAC51767.1| 312|Homo sapiens uncoupling protein-3 pr... 27 8.3 AF001787-1|AAC51369.1| 312|Homo sapiens uncoupling protein 3 pr... 27 8.3 AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. 27 8.3 AB002364-1|BAA20821.1| 1201|Homo sapiens KIAA0366 protein. 27 8.3 >J04982-1|AAA51736.1| 298|Homo sapiens ANT1 protein. Length = 298 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IAK EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >J02966-1|AAA61223.1| 297|Homo sapiens ANT1 protein. Length = 297 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IAK EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 256 CWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 295 >BC063643-1|AAH63643.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IAK EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC061589-1|AAH61589.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IAK EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC008664-1|AAH08664.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 72.9 bits (171), Expect = 2e-13 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IAK EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >M57424-1|AAA51737.1| 298|Homo sapiens adenine nucleotide translocator-2 protein. Length = 298 Score = 70.9 bits (166), Expect = 7e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IA+ EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >L78810-1|AAB39266.1| 298|Homo sapiens ANT-2 protein. Length = 298 Score = 70.9 bits (166), Expect = 7e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IA+ EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >J03591-1|AAA36749.1| 252|Homo sapiens protein ( Human ADP/ATP translocase mRNA, 3' end, clone pHAT3. ). Length = 252 Score = 70.9 bits (166), Expect = 7e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IA+ EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 211 CWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 250 >J02683-1|AAA35579.1| 298|Homo sapiens protein ( Human ADP/ATP carrier protein mRNA, complete cds. ). Length = 298 Score = 70.9 bits (166), Expect = 7e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IA+ EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >BC068199-1|AAH68199.1| 323|Homo sapiens SLC25A5 protein protein. Length = 323 Score = 70.9 bits (166), Expect = 7e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IA+ EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 282 CWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 321 >BC056160-1|AAH56160.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.9 bits (166), Expect = 7e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IA+ EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >AC004000-1|AAB96347.1| 298|Homo sapiens ADP/ATP carrier protein (adenine nucleotide translocator 2) protein. Length = 298 Score = 70.9 bits (166), Expect = 7e-13 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 CW IA+ EG AFFKGA+SNVLRG GGAFVLVLYDEIKK Sbjct: 257 CWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKK 296 >J03592-1|AAA36750.1| 262|Homo sapiens protein ( Human ADP/ATP translocase mRNA, 3' end, clone pHAT8. ). Length = 262 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 221 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 262 >CR457400-1|CAG33681.1| 298|Homo sapiens SLC25A6 protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC031912-1|AAH31912.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC014775-1|AAH14775.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC008935-1|AAH08935.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC008737-1|AAH08737.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC007850-1|AAH07850.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >BC007295-1|AAH07295.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >AY007135-1|AAG01998.1| 298|Homo sapiens protein ( Homo sapiens clone CDABP0051 mRNA sequence. ). Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >AL683870-1|CAI39843.1| 298|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 298 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 257 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 298 >AB209822-1|BAD93059.1| 323|Homo sapiens ADP,ATP carrier protein, liver isoform T2 variant protein. Length = 323 Score = 70.1 bits (164), Expect = 1e-12 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 128 CW I + EG AFFKGA+SNVLRG GGAFVLVLYDE+KKV+ Sbjct: 282 CWRKIFRDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVI 323 >BC022032-1|AAH22032.1| 315|Homo sapiens solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocato protein. Length = 315 Score = 62.5 bits (145), Expect = 2e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 C+ I + EG S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 267 CFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >AY550240-1|AAT42263.1| 315|Homo sapiens sperm flagellar energy carrier protein protein. Length = 315 Score = 62.5 bits (145), Expect = 2e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 C+ I + EG S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 267 CFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >AJ863129-1|CAI05952.1| 315|Homo sapiens ADP/ATP carrier isoform 4 protein. Length = 315 Score = 62.5 bits (145), Expect = 2e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 C+ I + EG S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 267 CFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >AC093591-1|AAY40974.1| 315|Homo sapiens unknown protein. Length = 315 Score = 62.5 bits (145), Expect = 2e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEIKK 122 C+ I + EG S+FF+GAFSNVLRGTGGA VLVLYD+IK+ Sbjct: 267 CFVKIYQHEGISSFFRGAFSNVLRGTGGALVLVLYDKIKE 306 >X96924-1|CAA65633.1| 318|Homo sapiens mitochondrial citrate transport protein protein. Length = 318 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 C I K EG AF+KG + R A V V+YDE+ K+L Sbjct: 269 CGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLL 311 >U25147-1|AAB08515.1| 311|Homo sapiens citrate transporter protein protein. Length = 311 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 C I K EG AF+KG + R A V V+YDE+ K+L Sbjct: 262 CGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLL 304 >L76134-1|AAL40091.1| 311|Homo sapiens citrate transport protein protein. Length = 311 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 C I K EG AF+KG + R A V V+YDE+ K+L Sbjct: 262 CGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLL 304 >L75823-1|AAL40090.1| 311|Homo sapiens citrate transport protein protein. Length = 311 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 C I K EG AF+KG + R A V V+YDE+ K+L Sbjct: 262 CGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLL 304 >BC008061-1|AAH08061.1| 311|Homo sapiens solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 protein. Length = 311 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 C I K EG AF+KG + R A V V+YDE+ K+L Sbjct: 262 CGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLL 304 >BC004980-1|AAH04980.1| 311|Homo sapiens solute carrier family 25 (mitochondrial carrier; citrate transporter), member 1 protein. Length = 311 Score = 32.3 bits (70), Expect = 0.29 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 C I K EG AF+KG + R A V V+YDE+ K+L Sbjct: 262 CGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEVVKLL 304 >BC113365-1|AAI13366.1| 299|Homo sapiens solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 protein. Length = 299 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 9 ATIAKTEGTSAFFKGAFSNVLR-GTGGAFVLVLYD 110 AT+ + EG A +KG ++R G GGA +L++Y+ Sbjct: 255 ATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYE 289 >BC101521-1|AAI01522.1| 299|Homo sapiens solute carrier family 25 (mitochondrial oxodicarboxylate carrier), member 21 protein. Length = 299 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 9 ATIAKTEGTSAFFKGAFSNVLR-GTGGAFVLVLYD 110 AT+ + EG A +KG ++R G GGA +L++Y+ Sbjct: 255 ATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYE 289 >AJ278148-1|CAC27562.1| 299|Homo sapiens oxodicarboxylate carrier protein. Length = 299 Score = 31.9 bits (69), Expect = 0.39 Identities = 14/35 (40%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 9 ATIAKTEGTSAFFKGAFSNVLR-GTGGAFVLVLYD 110 AT+ + EG A +KG ++R G GGA +L++Y+ Sbjct: 255 ATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYE 289 >AL358817-5|CAI13858.1| 1223|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 14 protein. Length = 1223 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 PL+SC + HE+ FS+ F++ Sbjct: 378 PLRSCALNHEDGFSSAFVI 396 >AL358817-4|CAI13857.1| 1226|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 14 protein. Length = 1226 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 PL+SC + HE+ FS+ F++ Sbjct: 381 PLRSCALNHEDGFSSAFVI 399 >AL355344-5|CAI41277.1| 1223|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 14 protein. Length = 1223 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 PL+SC + HE+ FS+ F++ Sbjct: 378 PLRSCALNHEDGFSSAFVI 396 >AL355344-4|CAI41278.1| 1226|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 14 protein. Length = 1226 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 PL+SC + HE+ FS+ F++ Sbjct: 381 PLRSCALNHEDGFSSAFVI 399 >AJ345098-1|CAC87943.1| 1223|Homo sapiens metalloprotease-disintegrin protease protein. Length = 1223 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 PL+SC + HE+ FS+ F++ Sbjct: 378 PLRSCALNHEDGFSSAFVI 396 >AF366351-1|AAL79814.1| 1159|Homo sapiens ADAMTS14 protein. Length = 1159 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 PL+SC + HE+ FS+ F++ Sbjct: 314 PLRSCALNHEDGFSSAFVI 332 >AF358666-1|AAL40229.1| 1223|Homo sapiens a disintegrin-like and metalloprotease with thrombospondin type 1 motif 14 prec protein. Length = 1223 Score = 28.3 bits (60), Expect = 4.8 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 PL+SC + HE+ FS+ F++ Sbjct: 378 PLRSCALNHEDGFSSAFVI 396 >BC016932-1|AAH16932.1| 678|Homo sapiens solute carrier family 25 (mitochondrial carrier, Aralar), member 12 protein. Length = 678 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGG-AFVLVLYDEIKK 122 C+ I + EG SAF+KG + V R + LV Y+ +++ Sbjct: 563 CFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQR 603 >AJ496568-1|CAD43090.1| 678|Homo sapiens mitochondrial aspartate-glutamate carrier protein protein. Length = 678 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGG-AFVLVLYDEIKK 122 C+ I + EG SAF+KG + V R + LV Y+ +++ Sbjct: 563 CFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQR 603 >AC068039-2|AAY24134.1| 678|Homo sapiens unknown protein. Length = 678 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGG-AFVLVLYDEIKK 122 C+ I + EG SAF+KG + V R + LV Y+ +++ Sbjct: 563 CFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYELLQR 603 >Y14494-1|CAA74834.1| 678|Homo sapiens aralar1 protein. Length = 678 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 3 CWATIAKTEGTSAFFKGAFSNVLRGTGGAFVLVLYDEI 116 C+ I + EG SAF+KG + V R + V + + E+ Sbjct: 563 CFRKILREEGPSAFWKGTAARVFRSSPQFGVTLAHYEV 600 >U84763-1|AAC51367.1| 312|Homo sapiens UCP3 protein. Length = 312 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 6 WATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 + TIA+ EG +KG N++R +V YD +K+ L Sbjct: 166 YRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKL 207 >U82818-1|AAC51356.1| 275|Homo sapiens UCP3S protein. Length = 275 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 6 WATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 + TIA+ EG +KG N++R +V YD +K+ L Sbjct: 166 YRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKL 207 >BC132735-1|AAI32736.1| 1205|Homo sapiens ADAMTS3 protein protein. Length = 1205 Score = 27.5 bits (58), Expect = 8.3 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 P++SC + HE+ FS+ F+V Sbjct: 378 PVRSCTLNHEDGFSSAFVV 396 >BC130287-1|AAI30288.1| 1205|Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif, 3 protein. Length = 1205 Score = 27.5 bits (58), Expect = 8.3 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 P++SC + HE+ FS+ F+V Sbjct: 378 PVRSCTLNHEDGFSSAFVV 396 >AK074120-1|BAB84946.1| 1437|Homo sapiens FLJ00192 protein protein. Length = 1437 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 115 ISSYKTSTKAPPVPLRTLEKAPLKKAEVP 29 ISS +TS K+ PVP + ++ P+ K E P Sbjct: 1043 ISSPETSLKSSPVPYQDHDQPPVLKKERP 1071 >AJ003125-1|CAA05880.1| 1211|Homo sapiens procollagen I N-proteinase protein. Length = 1211 Score = 27.5 bits (58), Expect = 8.3 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 P++SC + HE+ FS+ F+V Sbjct: 388 PVRSCTLNHEDGFSSAFVV 406 >AF509504-1|AAM88322.1| 1537|Homo sapiens DOT1-like protein protein. Length = 1537 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 115 ISSYKTSTKAPPVPLRTLEKAPLKKAEVP 29 ISS +TS K+ PVP + ++ P+ K E P Sbjct: 1143 ISSPETSLKSSPVPYQDHDQPPVLKKERP 1171 >AF050113-1|AAG02284.1| 312|Homo sapiens uncoupling protein-3 protein. Length = 312 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 6 WATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 + TIA+ EG +KG N++R +V YD +K+ L Sbjct: 166 YRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKL 207 >AF012202-1|AAC51785.1| 300|Homo sapiens uncoupling protein 3 protein. Length = 300 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 6 WATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 + TIA+ EG +KG N++R +V YD +K+ L Sbjct: 154 YRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKL 195 >AF011449-1|AAC51767.1| 312|Homo sapiens uncoupling protein-3 protein. Length = 312 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 6 WATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 + TIA+ EG +KG N++R +V YD +K+ L Sbjct: 166 YRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKL 207 >AF001787-1|AAC51369.1| 312|Homo sapiens uncoupling protein 3 protein. Length = 312 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +3 Query: 6 WATIAKTEGTSAFFKGAFSNVLRGT-GGAFVLVLYDEIKKVL 128 + TIA+ EG +KG N++R +V YD +K+ L Sbjct: 166 YRTIAREEGVRGLWKGTLPNIMRNAIVNCAEVVTYDILKEKL 207 >AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. Length = 1285 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -3 Query: 115 ISSYKTSTKAPPVPLRTLEKAPLKKAEVP 29 ISS +TS K+ PVP + ++ P+ K E P Sbjct: 690 ISSPETSLKSSPVPYQDHDQPPVLKKERP 718 >AB002364-1|BAA20821.1| 1201|Homo sapiens KIAA0366 protein. Length = 1201 Score = 27.5 bits (58), Expect = 8.3 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 187 PLKSCIIRHENDFSNLFLV 243 P++SC + HE+ FS+ F+V Sbjct: 374 PVRSCTLNHEDGFSSAFVV 392 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,926,322 Number of Sequences: 237096 Number of extensions: 436193 Number of successful extensions: 747 Number of sequences better than 10.0: 60 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 76,859,062 effective HSP length: 72 effective length of database: 59,788,150 effective search space used: 1375127450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -