BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30093 (743 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 24 1.5 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 2.0 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 6.0 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 7.9 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 23.8 bits (49), Expect = 1.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 475 QHLVGETVFGVAHIFASFNDTFVHVTDLSGRETI 374 +H+VG V V ++ SFN T +V D RE I Sbjct: 21 EHMVGTIVVVVRGVWVSFNQTAQNV-DTFVREQI 53 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 417 SLNEAKMCATPNTVSPTK 470 ++NE + C+TP SPTK Sbjct: 427 NVNENQDCSTPTENSPTK 444 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +3 Query: 480 PRVTWTSSLALCFFSGPWLS 539 P WTS + F G WLS Sbjct: 290 PIHVWTSKEKISFLRGFWLS 309 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 625 PDGKNFEIIFELVHN 581 P G NFEI FE +N Sbjct: 319 PAGSNFEIGFENYYN 333 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,882 Number of Sequences: 336 Number of extensions: 3921 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -