BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30093 (743 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 1.7 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 4.0 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 9.2 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 9.2 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 1.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 324 DASSRSAFTFMPPVTRAIVSRPDKSVT 404 +A R FT+ + ++I+ PDK +T Sbjct: 500 NADVRPPFTYASLIRQSIIESPDKQLT 526 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 4.0 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 1/54 (1%) Frame = -3 Query: 306 WRHRM*QRNAKLLA*RPSHKAPCYWWKQNKDPWSWCSVCTSG-SCSFKYEDWPH 148 WR +NAK + Y W + + S T SC+ K+E +PH Sbjct: 88 WRPDCFFKNAKKVTFHEMSIPNHYLWLYHDKTLLYMSKLTLVLSCAMKFESYPH 141 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 457 TVFGVAHIFASFNDTFVHVTDLSGRETI 374 ++F + IF N+T VTD ET+ Sbjct: 12 SIFLILIIFIYSNETIAQVTDDENCETL 39 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.4 bits (43), Expect = 9.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 457 TVFGVAHIFASFNDTFVHVTDLSGRETI 374 ++F + IF N+T VTD ET+ Sbjct: 12 SIFLILIIFIYSNETIAQVTDDENCETL 39 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,719 Number of Sequences: 438 Number of extensions: 4244 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -