BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30090 (820 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.3 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 2.2 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 23 2.2 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 23 2.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.7 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 21 8.9 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 324 SILLGFLRTGNSVFRPGLCA 265 S LL FL++GN + RP C+ Sbjct: 701 SELLDFLKSGNRLARPANCS 720 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 23.4 bits (48), Expect = 2.2 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 3/59 (5%) Frame = -1 Query: 319 SVGFLK---NW*QCLSPWTLRKILTGNNISRRGTFCRSSWIGDFFEFPTIWLVQQDQQF 152 ++ F+K W Q + W ++L GN RR + +I F TI L Q +F Sbjct: 408 NIAFIKLATEWPQLMKAWLKIELLVGNLGMRRNFRKKLDFIFTFITLLTIGLYFQLCEF 466 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Frame = -2 Query: 795 SQLSSIFFLPETKSGL---CGIRRVNVTNWFHN 706 S LS+ + E K L CGI V+NWF N Sbjct: 251 SHLSNPYPSEEAKEELARKCGITVSQVSNWFGN 283 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 23.4 bits (48), Expect = 2.2 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +3 Query: 207 IHELRQNVPRLEILLPVNILRKVQGERHCYQFL 305 +H L + P + P N L + RH Y F+ Sbjct: 95 VHRLEEYYPNPDKFDPDNFLPERTANRHYYSFI 127 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 683 LVVSLVYLNKITVHIFHFLNLRHN 612 LVV L+ LNK +H+ L +R N Sbjct: 1281 LVVFLLQLNKDQIHVKWPLGVRTN 1304 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 683 LVVSLVYLNKITVHIFHFLNLRHN 612 LVV L+ LNK +H+ L +R N Sbjct: 1281 LVVFLLQLNKDQIHVKWPLGVRTN 1304 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 21.4 bits (43), Expect = 8.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 728 LTRLIPHRPDLVSGRKNIDDNCEQ 799 LT++ P R RKN+ D C + Sbjct: 250 LTKMRPKRQSSRRHRKNLKDPCRR 273 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,000 Number of Sequences: 336 Number of extensions: 3959 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -