BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30090 (820 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g27840.1 68417.m03998 expressed protein 30 2.1 At2g36370.1 68415.m04463 F-box family protein (FBL11) contains s... 28 8.6 >At4g27840.1 68417.m03998 expressed protein Length = 260 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +2 Query: 272 SPGRK--TLLPVLKKPNRIEKYQKHISTATTNESH 370 S GRK L+P+L KP R+ K +K + T +E H Sbjct: 159 SKGRKGGALMPLLGKPLRVLKNKKRLQTEAKSEGH 193 >At2g36370.1 68415.m04463 F-box family protein (FBL11) contains similarity to leucine-rich repeats containing F-box protein FBL3 GI:5919219 from [Homo sapiens] Length = 785 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 245 IITG*YFAQSPGRKTLLPVLKKPNRIEKYQKHISTAT 355 I+ YFA RK+L LK P+ E++Q+ IS T Sbjct: 289 ILPNSYFANLRWRKSLESFLKNPDDDERHQEQISHRT 325 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,866,215 Number of Sequences: 28952 Number of extensions: 333693 Number of successful extensions: 828 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 828 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1872844800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -