BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30088 (828 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 4e-13 SB_37342| Best HMM Match : NOSIC (HMM E-Value=5.4e-33) 49 5e-06 SB_11837| Best HMM Match : Arylesterase (HMM E-Value=1.6e-10) 30 2.6 SB_9798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_25617| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 >SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 72.5 bits (170), Expect = 4e-13 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +2 Query: 614 LNNYIMRCREWYGWHFPELGKIITDNTLFVKVVNSLAHET 733 LNNY+MRCREWYGWHFPELGKI+TDN + K V + T Sbjct: 87 LNNYVMRCREWYGWHFPELGKIVTDNLAYAKTVKKMGMRT 126 Score = 47.2 bits (107), Expect = 2e-05 Identities = 39/100 (39%), Positives = 47/100 (47%), Gaps = 1/100 (1%) Frame = +3 Query: 525 LSRYKLKFSPDKIDTMIVQAQCXXXXXXXXXXXXS*GAVNGMVGISQSLGKSSLITLCL* 704 LSRYKLKFSPDK+DTMIVQA LGK L Sbjct: 57 LSRYKLKFSPDKVDTMIVQAISLLDDLDKELNNYVMRCREWYGWHFPELGKIVTDNLAYA 116 Query: 705 KW*THWHTRLCIQD-*FI*HLPEDLEEKVKEAAEISMGLK 821 K R + F LPE++EE++K AAEISMG++ Sbjct: 117 KTVKKMGMRTKAGELDFSEILPEEVEEELKTAAEISMGVE 156 >SB_37342| Best HMM Match : NOSIC (HMM E-Value=5.4e-33) Length = 300 Score = 48.8 bits (111), Expect = 5e-06 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +2 Query: 614 LNNYIMRCREWYGWHFPELGKIITDNTLFVKV 709 +N + MR REWY +HFPEL KI+ DN ++ KV Sbjct: 116 INTFSMRIREWYSYHFPELVKIVNDNYMYAKV 147 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +3 Query: 507 LGLAHSLSRYKLKFSPDKIDTMIVQA 584 LGL HS SR K+KF+ ++D MI+Q+ Sbjct: 80 LGLGHSYSRAKVKFNIHRVDNMIIQS 105 >SB_11837| Best HMM Match : Arylesterase (HMM E-Value=1.6e-10) Length = 263 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +2 Query: 83 SSMLVLFETPAGYAIFKLLDESKLSEIDNLYQ-EFNTPEGASTVVKLKNF 229 SS L LF + Y + +D S NLY + N P A ++ LKNF Sbjct: 56 SSGLALFSSGLRYTVQLTIDPSIKLRKGNLYLLDLNEPNSAPVILTLKNF 105 >SB_9798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +2 Query: 653 WHFPELGKIITDNTLFVKVVNSLAHETMHPRLIYLTFT 766 W+FP +I L ++ +NS+ +T+ +L+Y++ T Sbjct: 42 WNFPVTSLLINHQCLTLEQLNSIPEKTLQYQLVYVSRT 79 >SB_25617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 344 INSLSVTLSWVVPLEKNLTYNVYQILMSRNCSG 442 +NS ++TLSW VP +VY ++ C+G Sbjct: 279 LNSSAITLSWSVPNNTGGRTDVYYLIECFKCNG 311 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,781,135 Number of Sequences: 59808 Number of extensions: 462178 Number of successful extensions: 1110 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1110 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -