BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30087X (311 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC063008-1|AAH63008.1| 752|Homo sapiens two pore segment channe... 28 5.0 AY029200-1|AAK31802.1| 752|Homo sapiens two-pore calcium channe... 28 5.0 >BC063008-1|AAH63008.1| 752|Homo sapiens two pore segment channel 2 protein. Length = 752 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -3 Query: 207 YYHICMRVLSFI*SIFLFHHKILYITKVVSQTNVRFY*WPDLTPLGLITSLPTL 46 Y ++C R LSF + LF I + + S +VR+ P P GL S+ L Sbjct: 78 YSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVL 131 >AY029200-1|AAK31802.1| 752|Homo sapiens two-pore calcium channel protein 2 protein. Length = 752 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -3 Query: 207 YYHICMRVLSFI*SIFLFHHKILYITKVVSQTNVRFY*WPDLTPLGLITSLPTL 46 Y ++C R LSF + LF I + + S +VR+ P P GL S+ L Sbjct: 78 YSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEPPCGLTESVEVL 131 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 41,623,665 Number of Sequences: 237096 Number of extensions: 735328 Number of successful extensions: 1210 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 76,859,062 effective HSP length: 78 effective length of database: 58,365,574 effective search space used: 1459139350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -