BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30084 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) 33 0.27 SB_44745| Best HMM Match : zf-C2H2 (HMM E-Value=2.2e-05) 31 1.1 SB_53329| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 30 1.4 SB_36935| Best HMM Match : Somatomedin_B (HMM E-Value=1.8e-06) 29 3.3 SB_38952| Best HMM Match : 7tm_2 (HMM E-Value=1.7e-21) 29 3.3 SB_35568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_6299| Best HMM Match : RVT_1 (HMM E-Value=6.1e-33) 29 4.4 SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1) 28 5.8 SB_26070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_42290| Best HMM Match : Band_41 (HMM E-Value=3.6e-09) Length = 474 Score = 32.7 bits (71), Expect = 0.27 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 53 CPCACIPYCTDSCKDANHYCPNCNAYI 133 CPC + YC +C +YCP C +I Sbjct: 419 CPCGHV-YCCQTCASNLYYCPLCKTFI 444 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 53 CPCACIPYCTDSCKDANHYCPNCNAYIGSYNR*IFQL 163 CPC + +C+ C D +CP CN + + F + Sbjct: 362 CPCGHLMFCS-RCADNMKFCPLCNESVNGNQKIYFAM 397 >SB_44745| Best HMM Match : zf-C2H2 (HMM E-Value=2.2e-05) Length = 572 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 586 TKMQLTGVIFKYLKLQSVV*NVGTLKLFFKKYN-KNCFPSKI 464 TKM +++ L + +GTLK F +KYN +N P K+ Sbjct: 218 TKMSFLQLVYTKLYSAESIREIGTLKFFREKYNRRNVTPEKV 259 >SB_53329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -1 Query: 586 TKMQLTGVIFKYLKLQSVV*NVGTLKLFFKKYN-KNCFPSKI 464 TKM +++ L + +GTLK F +KYN +N P K+ Sbjct: 218 TKMSFLQLVYTKLYSAESIREIGTLKFFREKYNRRNVTPEKV 259 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +2 Query: 44 IGCCPCACIPYCTDSCKDANHYCPNCNAYI 133 I CP C P C+D C Y PN + ++ Sbjct: 705 IAPCPQVCAPACSDICCGFGAYAPNPDTHV 734 >SB_36935| Best HMM Match : Somatomedin_B (HMM E-Value=1.8e-06) Length = 231 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +2 Query: 59 CACIPYCT---DSCKDANHYCP 115 C C PYCT D C D + +CP Sbjct: 209 CRCDPYCTSFKDCCADFDTFCP 230 >SB_38952| Best HMM Match : 7tm_2 (HMM E-Value=1.7e-21) Length = 959 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/22 (50%), Positives = 13/22 (59%), Gaps = 3/22 (13%) Frame = +2 Query: 59 CACIPYCT---DSCKDANHYCP 115 C C PYCT D C D + +CP Sbjct: 142 CRCDPYCTSFKDCCADFDTFCP 163 >SB_35568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 28.7 bits (61), Expect = 4.4 Identities = 9/24 (37%), Positives = 21/24 (87%) Frame = +1 Query: 100 KPLLSELQRVHWKLQSLNISVGSI 171 KPL S +Q++H+K++++N+++ +I Sbjct: 530 KPLNSLVQKIHFKMENINVALDAI 553 >SB_6299| Best HMM Match : RVT_1 (HMM E-Value=6.1e-33) Length = 283 Score = 28.7 bits (61), Expect = 4.4 Identities = 9/24 (37%), Positives = 21/24 (87%) Frame = +1 Query: 100 KPLLSELQRVHWKLQSLNISVGSI 171 KPL S +Q++H+K++++N+++ +I Sbjct: 101 KPLNSFVQKIHFKMENINVALDAI 124 >SB_19475| Best HMM Match : C_tripleX (HMM E-Value=0.1) Length = 530 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 32 LLCLIGCCPCACIPYCTDSCKDANHYCPN 118 L C +GC P C P CT +C PN Sbjct: 441 LTCPVGC-PSMCAPSCTPACCAEQQCWPN 468 >SB_26070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -3 Query: 125 RCNSDSNGLHLCRSPCSKGYKH-MGNNLLGK 36 RC DSN + ++ C K Y++ G+NL GK Sbjct: 3 RCEQDSNLRGILQTKCRKMYRYGQGSNLRGK 33 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 5/51 (9%) Frame = +2 Query: 188 NNILVLLFNS----ILSYELSI-ALNRFAFYLEEQIGLNVFEDTYKNRVLF 325 +N LV+ +S + SYE N+ +Y++++ GLN+ +D +KN + + Sbjct: 638 HNSLVITLSSAAQLVPSYEFPTNTKNKSVYYIKKEKGLNIGKDNFKNALSY 688 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,189,688 Number of Sequences: 59808 Number of extensions: 365052 Number of successful extensions: 847 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 843 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -