BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30084 (658 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BX537543-1|CAD97778.1| 161|Homo sapiens hypothetical protein pr... 58 2e-08 BC101969-1|AAI01970.1| 161|Homo sapiens LPS-induced TNF-alpha f... 58 2e-08 BC101402-1|AAI01403.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC101401-1|AAI01402.1| 161|Homo sapiens LPS-induced TNF-alpha f... 58 2e-08 BC096066-1|AAH96066.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC096065-1|AAH96065.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC096063-1|AAH96063.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC046154-1|AAH46154.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC039840-1|AAH39840.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC016491-1|AAH16491.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC008309-1|AAH08309.1| 161|Homo sapiens lipopolysaccharide-indu... 58 2e-08 BC000053-1|AAH00053.1| 161|Homo sapiens LITAF protein protein. 58 2e-08 AB034747-1|BAB32547.1| 161|Homo sapiens small integral membrane... 58 2e-08 DQ167023-1|AAZ94626.1| 208|Homo sapiens cell death inducing pro... 42 0.003 CR533446-1|CAG38477.1| 208|Homo sapiens C16orf5 protein. 42 0.003 BC007604-1|AAH07604.1| 125|Homo sapiens Unknown (protein for IM... 42 0.003 BC002882-1|AAH02882.1| 208|Homo sapiens chromosome 16 open read... 42 0.003 AF195661-1|AAG35583.1| 208|Homo sapiens transmembrane protein I... 42 0.003 AF131218-1|AAF26619.1| 261|Homo sapiens chromosome 16 open read... 33 0.90 AJ628247-1|CAF31639.1| 221|Homo sapiens keratin associated prot... 31 3.6 AB126074-1|BAD20201.1| 221|Homo sapiens keratin associated prot... 31 3.6 >BX537543-1|CAD97778.1| 161|Homo sapiens hypothetical protein protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC101969-1|AAI01970.1| 161|Homo sapiens LPS-induced TNF-alpha factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC101402-1|AAI01403.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC101401-1|AAI01402.1| 161|Homo sapiens LPS-induced TNF-alpha factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC096066-1|AAH96066.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC096065-1|AAH96065.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC096063-1|AAH96063.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC046154-1|AAH46154.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC039840-1|AAH39840.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC016491-1|AAH16491.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC008309-1|AAH08309.1| 161|Homo sapiens lipopolysaccharide-induced TNF factor protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >BC000053-1|AAH00053.1| 161|Homo sapiens LITAF protein protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >AB034747-1|BAB32547.1| 161|Homo sapiens small integral membrane protein of lysosome/late endosome protein. Length = 161 Score = 58.4 bits (135), Expect = 2e-08 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = +2 Query: 35 LCLIGCCP-CACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 LCL+GC C IP+C D+ +D +HYCPNC A +G+Y R Sbjct: 122 LCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKR 160 >DQ167023-1|AAZ94626.1| 208|Homo sapiens cell death inducing protein protein. Length = 208 Score = 41.5 bits (93), Expect = 0.003 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 38 CLIGC-CPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 C +GC C IP + KD H CP+C AYI +Y R Sbjct: 169 CFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >CR533446-1|CAG38477.1| 208|Homo sapiens C16orf5 protein. Length = 208 Score = 41.5 bits (93), Expect = 0.003 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 38 CLIGC-CPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 C +GC C IP + KD H CP+C AYI +Y R Sbjct: 169 CFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >BC007604-1|AAH07604.1| 125|Homo sapiens Unknown (protein for IMAGE:3350242) protein. Length = 125 Score = 41.5 bits (93), Expect = 0.003 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 38 CLIGC-CPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 C +GC C IP + KD H CP+C AYI +Y R Sbjct: 86 CFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKR 123 >BC002882-1|AAH02882.1| 208|Homo sapiens chromosome 16 open reading frame 5 protein. Length = 208 Score = 41.5 bits (93), Expect = 0.003 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 38 CLIGC-CPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 C +GC C IP + KD H CP+C AYI +Y R Sbjct: 169 CFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >AF195661-1|AAG35583.1| 208|Homo sapiens transmembrane protein I1 protein. Length = 208 Score = 41.5 bits (93), Expect = 0.003 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 38 CLIGC-CPCACIPYCTDSCKDANHYCPNCNAYIGSYNR 148 C +GC C IP + KD H CP+C AYI +Y R Sbjct: 169 CFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYIYTYKR 206 >AF131218-1|AAF26619.1| 261|Homo sapiens chromosome 16 open reading frame 5 protein. Length = 261 Score = 33.1 bits (72), Expect = 0.90 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +2 Query: 38 CLIGC-CPCACIPYCTDSCKDANHYCPNCNA 127 C +GC C IP + KD H CP+C A Sbjct: 169 CFMGCDLGCCLIPCLINDFKDVTHTCPSCKA 199 >AJ628247-1|CAF31639.1| 221|Homo sapiens keratin associated protein 5-11 protein. Length = 221 Score = 31.1 bits (67), Expect = 3.6 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +2 Query: 38 CLIGCC-PCACIPYCTDSCKDANHYCPNC 121 C CC PC+C C SC ++ Y P C Sbjct: 178 CQSSCCKPCSCFSGCGSSCCQSSCYKPCC 206 >AB126074-1|BAD20201.1| 221|Homo sapiens keratin associated protein protein. Length = 221 Score = 31.1 bits (67), Expect = 3.6 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +2 Query: 38 CLIGCC-PCACIPYCTDSCKDANHYCPNC 121 C CC PC+C C SC ++ Y P C Sbjct: 178 CQSSCCKPCSCFSGCGSSCCQSSCYKPCC 206 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,196,283 Number of Sequences: 237096 Number of extensions: 1786992 Number of successful extensions: 3601 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 3285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3580 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7366354010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -