BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30084 (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 23 2.6 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 22 4.5 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 4.5 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 7.8 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 23.0 bits (47), Expect = 2.6 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 546 LRYLNITPVSCIFVYFLITFI*LMYFITLCKRI 644 +R LNI VS +F FL + + Y+I + I Sbjct: 396 MRALNIDRVSRVFFPFLFAVLNVTYWIMFAEYI 428 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 629 CNKIH*LNKCDQE 591 CNKI+ L KC QE Sbjct: 123 CNKIYNLAKCVQE 135 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 629 CNKIH*LNKCDQE 591 CNKI+ L KC QE Sbjct: 123 CNKIYNLAKCVQE 135 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 7.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 516 VPTF*TTLCSLRYLNITPVSCIFVYFLITF 605 VP T CS YL T IFV + TF Sbjct: 189 VPEGFLTSCSFDYLTDTNEIRIFVATIFTF 218 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,914 Number of Sequences: 438 Number of extensions: 3517 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -