BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30084 (658 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g66610.1 68414.m07569 seven in absentia (SINA) protein, putat... 28 4.8 At1g66630.1 68414.m07571 seven in absentia (SINA) family protein... 28 6.3 At4g14260.1 68417.m02199 expressed protein contains Pfam profile... 27 8.3 >At1g66610.1 68414.m07569 seven in absentia (SINA) protein, putative similar to SIAH1 protein [Brassica napus var. napus] GI:7657876; contains Pfam profile PF03145: Seven in absentia protein family Length = 366 Score = 28.3 bits (60), Expect = 4.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +2 Query: 77 CTDSCKDANHYCPNCNAYIGSYNR*IFQLV 166 C+ C + ++ CP C+ IG+Y I + V Sbjct: 77 CSSCCTNVSNKCPYCSLAIGNYRSRIMERV 106 >At1g66630.1 68414.m07571 seven in absentia (SINA) family protein similar to SIAH1 protein [Brassica napus var. napus] GI:7657876; contains Pfam profile PF03145: Seven in absentia protein family Length = 303 Score = 27.9 bits (59), Expect = 6.3 Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 77 CTDSCKDANHYCPNCNAYIGSYNR*IFQLV--Q*IINCKN 190 C+ CK + CP C+ IG + I + + +++C N Sbjct: 70 CSSCCKKVKYKCPYCSLRIGFFRSRILEKIVEAVVVSCPN 109 >At4g14260.1 68417.m02199 expressed protein contains Pfam profile PF03478: Protein of unknown function (DUF295); expression supported by MPSS Length = 379 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +3 Query: 489 LYFLKNNFNVPTF*TTLCSLRYLNITPVSCI-FVYF 593 +YF+ NNF V T CS Y ++ P+ + F Y+ Sbjct: 337 IYFVGNNFGVYDLTTETCSTFYTSVRPLKNVSFPYW 372 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,809,484 Number of Sequences: 28952 Number of extensions: 251535 Number of successful extensions: 578 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1373722560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -