BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30073 (348 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) 153 4e-38 SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) 153 4e-38 SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) 153 4e-38 SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) 153 4e-38 SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) 153 4e-38 SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) 153 4e-38 SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) 153 4e-38 SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) 153 4e-38 SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) 153 4e-38 SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) 153 4e-38 SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) 152 7e-38 SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) 149 6e-37 SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) 149 8e-37 SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) 140 3e-34 SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) 122 8e-29 SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) 91 2e-19 SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) 63 5e-11 SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) 63 5e-11 SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) 63 5e-11 SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) 62 1e-10 SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) 62 1e-10 SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) 56 1e-08 SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) 54 3e-08 SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) 38 0.002 SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) 34 0.036 SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.26 SB_11512| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) 28 1.8 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 28 1.8 SB_37750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 1.8 SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) 28 1.8 SB_6385| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00099) 27 3.2 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.2 SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) 27 5.5 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 26 7.3 SB_29945| Best HMM Match : DUF125 (HMM E-Value=1.7) 23 8.1 SB_32588| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.7 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.7 >SB_48961| Best HMM Match : Tubulin (HMM E-Value=0) Length = 536 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 352 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 411 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 412 LEKDYEEVGVDS 423 >SB_37573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 305 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 364 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 365 LEKDYEEVGVDS 376 >SB_22193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1231 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 1148 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 1207 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 1208 LEKDYEEVGVDS 1219 Score = 144 bits (350), Expect = 1e-35 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 739 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 798 Query: 183 LEKDYEE 203 LEKDYEE Sbjct: 799 LEKDYEE 805 >SB_22192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 368 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 427 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 428 LEKDYEEVGVDS 439 >SB_22190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 333 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 392 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 393 LEKDYEEVGVDS 404 >SB_19437| Best HMM Match : Tubulin (HMM E-Value=0) Length = 885 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 801 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 860 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 861 LEKDYEEVGVDS 872 Score = 144 bits (349), Expect = 2e-35 Identities = 66/67 (98%), Positives = 67/67 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTA+AEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 368 LAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 427 Query: 183 LEKDYEE 203 LEKDYEE Sbjct: 428 LEKDYEE 434 >SB_2674| Best HMM Match : Tubulin (HMM E-Value=0) Length = 1036 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 953 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 1012 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 1013 LEKDYEEVGVDS 1024 >SB_51156| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 377 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 293 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 352 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 353 LEKDYEEVGVDS 364 >SB_23895| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 250 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 166 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 225 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 226 LEKDYEEVGVDS 237 >SB_2003| Best HMM Match : Tubulin (HMM E-Value=0) Length = 451 Score = 153 bits (371), Expect = 4e-38 Identities = 71/72 (98%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 368 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 427 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 428 LEKDYEEVGVDS 439 >SB_42897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 152 bits (369), Expect = 7e-38 Identities = 71/72 (98%), Positives = 71/72 (98%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 520 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 579 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG DS Sbjct: 580 LEKDYEEVGADS 591 >SB_22191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 149 bits (361), Expect = 6e-37 Identities = 69/72 (95%), Positives = 71/72 (98%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 784 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 843 Query: 183 LEKDYEEVGMDS 218 LEKDYEEV ++S Sbjct: 844 LEKDYEEVAVES 855 Score = 144 bits (350), Expect = 1e-35 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 353 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 412 Query: 183 LEKDYEE 203 LEKDYEE Sbjct: 413 LEKDYEE 419 >SB_47795| Best HMM Match : Tubulin_C (HMM E-Value=0.24) Length = 149 Score = 149 bits (360), Expect = 8e-37 Identities = 68/72 (94%), Positives = 72/72 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQR+VCMLSNTTAIA+AWARL+HKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 66 LAKVQRSVCMLSNTTAIADAWARLNHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 125 Query: 183 LEKDYEEVGMDS 218 LEKDYEEVG+DS Sbjct: 126 LEKDYEEVGVDS 137 >SB_51150| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 232 Score = 140 bits (339), Expect = 3e-34 Identities = 64/67 (95%), Positives = 67/67 (100%) Frame = +3 Query: 3 LAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 182 LAKVQR+VCMLSNTTAIA+AWARL+HKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA Sbjct: 166 LAKVQRSVCMLSNTTAIADAWARLNHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAA 225 Query: 183 LEKDYEE 203 LEKDYEE Sbjct: 226 LEKDYEE 232 >SB_5512| Best HMM Match : Tubulin (HMM E-Value=0) Length = 365 Score = 122 bits (294), Expect = 8e-29 Identities = 55/56 (98%), Positives = 56/56 (100%) Frame = +3 Query: 51 IAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 218 IAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DS Sbjct: 297 IAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 352 >SB_57880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 91.1 bits (216), Expect = 2e-19 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +3 Query: 84 FDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 218 +D YAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG+DS Sbjct: 9 YDHDYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 53 >SB_47198| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 63.3 bits (147), Expect = 5e-11 Identities = 24/64 (37%), Positives = 43/64 (67%) Frame = +3 Query: 12 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK 191 ++ + + N+TAI E + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 361 LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS 420 Query: 192 DYEE 203 +Y++ Sbjct: 421 EYQQ 424 >SB_39308| Best HMM Match : Tubulin (HMM E-Value=0) Length = 391 Score = 63.3 bits (147), Expect = 5e-11 Identities = 24/64 (37%), Positives = 43/64 (67%) Frame = +3 Query: 12 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK 191 ++ + + N+TAI E + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 306 LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS 365 Query: 192 DYEE 203 +Y++ Sbjct: 366 EYQQ 369 >SB_17879| Best HMM Match : Tubulin (HMM E-Value=0) Length = 446 Score = 63.3 bits (147), Expect = 5e-11 Identities = 24/64 (37%), Positives = 43/64 (67%) Frame = +3 Query: 12 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK 191 ++ + + N+TAI E + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 361 LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS 420 Query: 192 DYEE 203 +Y++ Sbjct: 421 EYQQ 424 >SB_44780| Best HMM Match : 7tm_1 (HMM E-Value=1.2e-34) Length = 747 Score = 62.1 bits (144), Expect = 1e-10 Identities = 25/64 (39%), Positives = 42/64 (65%) Frame = +3 Query: 12 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK 191 ++ A + N TAI E + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 126 LKMAATFVGNNTAIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMHDLIA 185 Query: 192 DYEE 203 +Y++ Sbjct: 186 EYQQ 189 >SB_17651| Best HMM Match : Tubulin_C (HMM E-Value=4.7e-28) Length = 271 Score = 62.1 bits (144), Expect = 1e-10 Identities = 25/64 (39%), Positives = 42/64 (65%) Frame = +3 Query: 12 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEK 191 ++ A + N TAI E + R+ +F M+ ++AF+HWY GEGM+E EF+EA ++ L Sbjct: 188 LKMAATFVGNNTAIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMHDLIA 247 Query: 192 DYEE 203 +Y++ Sbjct: 248 EYQQ 251 >SB_17880| Best HMM Match : Tubulin_C (HMM E-Value=0) Length = 375 Score = 55.6 bits (128), Expect = 1e-08 Identities = 26/61 (42%), Positives = 38/61 (62%) Frame = +3 Query: 21 AVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYE 200 A C+ SNT AI E + R+ + LM+ +RAF+HWY EGM+ +F EA D+ L Y+ Sbjct: 270 ASCISSNT-AIQELFKRIRLHYKLMFRRRAFLHWYTEEGMDSQQFEEADNDILDLISTYQ 328 Query: 201 E 203 + Sbjct: 329 Q 329 >SB_25311| Best HMM Match : Tubulin (HMM E-Value=0) Length = 629 Score = 54.0 bits (124), Expect = 3e-08 Identities = 23/54 (42%), Positives = 35/54 (64%) Frame = +3 Query: 12 VQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEARED 173 ++ A L N+TAI EA+ R +F M+ +RAF+HWY EGM+ EF+E + + Sbjct: 180 LKNAATFLYNSTAIQEAFRRFTEQFAAMFRRRAFLHWYTTEGMDPLEFTEIKRN 233 >SB_40336| Best HMM Match : Tubulin_C (HMM E-Value=1.3e-32) Length = 488 Score = 38.3 bits (85), Expect = 0.002 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 33 LSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVG-EGMEEGEFSEAREDLAALEKDY 197 L+N + I + L +F +Y ++A VH Y +G+E G+F + E L+ L ++Y Sbjct: 415 LANNSCIKNTFVELKDRFMKLYKRKAHVHHYTHVDGLEVGQFDDGLESLSWLIQEY 470 >SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) Length = 474 Score = 33.9 bits (74), Expect = 0.036 Identities = 18/61 (29%), Positives = 34/61 (55%) Frame = +3 Query: 15 QRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKD 194 +++V +LSN+ +++ K M+A RA+VH Y+ G+ E F ++ L + K+ Sbjct: 411 EKSVTLLSNSQTHVGPLSKVVGKAWTMFASRAYVHQYLRFGISEDAFVDSFACLEQVVKN 470 Query: 195 Y 197 Y Sbjct: 471 Y 471 >SB_23612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 31.1 bits (67), Expect = 0.26 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = -1 Query: 231 PRLQRSPCRLLRNPSRGQPGPHGLR---RTLPPPYPHRRTSARKH 106 PR QR +P+ P L R+ PPPYP RTS H Sbjct: 737 PRQQRMMTTTAHSPTAQSPSADSLGSSVRSPPPPYPGSRTSGNPH 781 >SB_11512| Best HMM Match : E-MAP-115 (HMM E-Value=1.4) Length = 639 Score = 28.3 bits (60), Expect = 1.8 Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 255 VSTLRLP--HPRLQRSPCRLLRNPSRGQPGPHGLRRTLPPPYPHRRTSA 115 V TL+ P PR R P R P+R QP P L R+ P P P R S+ Sbjct: 561 VDTLQTPIATPRSARPPSDSPR-PARPQPEPRHL-RSPPEPKPRHRDSS 607 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 28.3 bits (60), Expect = 1.8 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 192 PSRGQPGPHGLRRTLPPPYPHRRTSA 115 PSRG P P R + PPP P R +A Sbjct: 300 PSRGAPPPPPSRGSAPPPPPARMGTA 325 Score = 25.8 bits (54), Expect = 9.7 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -1 Query: 192 PSRGQ--PGPHGLRRTLPPPYPHRRTSAR 112 PSRG P P T PPP P R+S R Sbjct: 309 PSRGSAPPPPPARMGTAPPPPPPSRSSQR 337 >SB_37750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 759 Score = 28.3 bits (60), Expect = 1.8 Identities = 17/65 (26%), Positives = 27/65 (41%) Frame = +1 Query: 64 GLALTTSSTSCTPSVLSCTGTSVRVWRRESSPKPVRTWLPSRRITKKSAWTPLKARVREP 243 G L T T V+ C G +W + + P+ + R S +T L+ + E Sbjct: 110 GTLLLTIHIYLTTGVILCQGIGFYIWAKLAFPRLKEAVDNAIRSNDDSTFTELEKKKAEN 169 Query: 244 KSTNQ 258 K TN+ Sbjct: 170 KPTNE 174 >SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) Length = 2658 Score = 28.3 bits (60), Expect = 1.8 Identities = 21/49 (42%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -1 Query: 255 VSTLRLP--HPRLQRSPCRLLRNPSRGQPGPHGLRRTLPPPYPHRRTSA 115 V TL+ P PR R P R P+R QP P L R+ P P P R S+ Sbjct: 2580 VDTLQTPIATPRSARPPSDSPR-PARPQPEPRHL-RSPPEPKPRHRDSS 2626 >SB_6385| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00099) Length = 437 Score = 27.5 bits (58), Expect = 3.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 105 RAFVHWYVGEGMEEGEFSEAREDLAALEKDYEE 203 RAFV ++ EG EE D A +E+D EE Sbjct: 70 RAFVTRFMAEGCEEKTLEMMSRDDAFIEEDVEE 102 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 27.1 bits (57), Expect = 4.2 Identities = 21/54 (38%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = +1 Query: 67 LALTTSSTSCTPSVLS--CTGTSVRVWRRESSP-KPVRTWLPSRRITKKSAWTP 219 L L+T ST CTPS S T ++ R S+P P PS IT + TP Sbjct: 7 LKLSTPSTPCTPSTPSTPSTPSTPRTPSTPSTPCTPSTPSTPSTPITPSTPSTP 60 >SB_55337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1853 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 Query: 183 GQPGPHGLRRTLPPPYPHRRTSARKHAWRT*G 88 G PGP GLR + PP T +W + G Sbjct: 758 GNPGPPGLRGDVGPPGEQGPTGVPGESWTSGG 789 >SB_37864| Best HMM Match : Extensin_2 (HMM E-Value=0.064) Length = 1230 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 240 LPHPRLQRSPCRLLRNPSRGQPGPHGLRRTLPPPYPHR 127 +P+P +Q+ P + P++ +P P R P P P+R Sbjct: 527 IPNPMMQQQPLQYGPAPNKYRPAPQPYR---PAPEPYR 561 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 26.2 bits (55), Expect = 7.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -1 Query: 186 RGQPGPHGLRRTLPPPYP-HRRTSA 115 R P P R +PPP+P RRT A Sbjct: 1471 RRTPAPDPAERRVPPPFPAERRTPA 1495 >SB_29945| Best HMM Match : DUF125 (HMM E-Value=1.7) Length = 608 Score = 23.0 bits (47), Expect(2) = 8.1 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 10/43 (23%) Frame = -1 Query: 198 RNPSRGQPGPHG-----LRRTLPPPYPHR-----RTSARKHAW 100 R +R Q G HG RT Y R RT AR+HAW Sbjct: 223 RRHARTQEGAHGGITRRRARTYAETYTGRARAQTRTHARRHAW 265 Score = 21.4 bits (43), Expect(2) = 8.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 126 RTSARKHAWR 97 RT R+HAWR Sbjct: 288 RTHPRRHAWR 297 >SB_32588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 25.8 bits (54), Expect = 9.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 192 PSRGQPGPHGLRRTLPPPYPHRRTSARKHAWR 97 P+R PGPHG PPP P R+ WR Sbjct: 1036 PTRPIPGPHG--AATPPPGPPGGPEERR--WR 1063 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 25.8 bits (54), Expect = 9.7 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 192 PSRGQPGPHGLRRTLPPPYPHRR 124 PS G G HG + PPP P + Sbjct: 607 PSDGSQGSHGQKDPPPPPPPRNK 629 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,597,541 Number of Sequences: 59808 Number of extensions: 172238 Number of successful extensions: 704 Number of sequences better than 10.0: 38 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 702 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 523129866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -