BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30071 (739 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.6 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 4.5 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 22 4.5 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 7.9 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 382 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 281 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 382 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 281 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 382 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 281 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -1 Query: 382 PTVENLTAIGVLLPMDSNTLAALYLVMS*VTSKY 281 P + + G MDSN + A+Y+++ + + Y Sbjct: 356 PDISEIIPTGDDTTMDSNDMTAIYVLLINIFASY 389 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 213 NVIL*QGAYSRTSGHAKGAGAFGYFEVTHDITKYSAAK 326 N+ L + ++ + G G F V+H T YSA + Sbjct: 199 NIDLYEEIFNGNRANPNGCQIRGTFFVSHKYTNYSAVQ 236 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 213 NVIL*QGAYSRTSGHAKGAGAFGYFEVTHDITKYSAAK 326 N+ L + ++ + G G F V+H T YSA + Sbjct: 206 NIDLYEEIFNGNRANPNGCQIRGTFFVSHKYTNYSAVQ 243 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 7.9 Identities = 10/33 (30%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +1 Query: 49 RDPATDQLINYKKTLKDSPGFIT-TKSGAPVGI 144 + P++ ++ + T SPGF+T TK+ V + Sbjct: 65 KSPSSPRISSPSSTKSGSPGFLTYTKADRDVDL 97 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,212 Number of Sequences: 336 Number of extensions: 4413 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19779950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -