BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30069 (495 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 25 1.9 EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 2.5 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 4.3 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 4.3 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 4.3 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 24.6 bits (51), Expect = 1.9 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +3 Query: 84 GKMQLSADPRRADRERRYKPPPPTSAPAEDLT 179 G + A R D Y+PPP PA+ +T Sbjct: 69 GLLWRGATANRNDSSVHYQPPPTVHHPADAVT 100 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 24.2 bits (50), Expect = 2.5 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -1 Query: 297 TLEFAKLMLEQNTAATRTISISSLSHTLKIPSLKYS 190 TLE A+ + Q + T+++ T+ IPS Y+ Sbjct: 563 TLEIAQNIARQRLLSRNTVALPPRKDTVSIPSRGYA 598 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 4.3 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 198 LGMVFSMCGLMMRLKWCAWQLYFVPASVLQTQEFP 302 LG+ S G RL+ CA+ ++P V T P Sbjct: 667 LGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLP 701 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 23.4 bits (48), Expect = 4.3 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 198 LGMVFSMCGLMMRLKWCAWQLYFVPASVLQTQEFP 302 LG+ S G RL+ CA+ ++P V T P Sbjct: 667 LGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLP 701 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 23.4 bits (48), Expect = 4.3 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 198 LGMVFSMCGLMMRLKWCAWQLYFVPASVLQTQEFP 302 LG+ S G RL+ CA+ ++P V T P Sbjct: 553 LGLNTSFVGRGPRLRQCAFWKKYLPQLVAATSNLP 587 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,219 Number of Sequences: 2352 Number of extensions: 10665 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43977336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -