BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30067X (311 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81122-13|CAB03356.3| 368|Caenorhabditis elegans Hypothetical p... 28 1.6 AC024761-3|AAF59465.1| 159|Caenorhabditis elegans Hypothetical ... 27 2.8 >Z81122-13|CAB03356.3| 368|Caenorhabditis elegans Hypothetical protein T13F2.5 protein. Length = 368 Score = 27.9 bits (59), Expect = 1.6 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -1 Query: 113 ILENTLQYWNYLAK*FFFFYLSRQTSVRPHL 21 ILE L W+YL FFF L + P+L Sbjct: 43 ILETVLLLWSYLECGVFFFVLCTNSQYHPNL 73 >AC024761-3|AAF59465.1| 159|Caenorhabditis elegans Hypothetical protein Y38C1AA.7 protein. Length = 159 Score = 27.1 bits (57), Expect = 2.8 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 116 LILENTLQYWNYLAK*FFFFYLSRQTSVRPH 24 L+L +L+ N+LAK F+F +L ++ H Sbjct: 30 LVLFGSLEDCNFLAKLFYFIFLGGAVAISAH 60 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,686,440 Number of Sequences: 27780 Number of extensions: 119216 Number of successful extensions: 214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 344570176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -