BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30067X (311 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52670.1 68416.m05802 F-box family protein contains F-box dom... 26 4.6 At1g76480.1 68414.m08897 expressed protein ; expression support... 25 8.1 >At3g52670.1 68416.m05802 F-box family protein contains F-box domain Pfam:PF00646 Length = 384 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = -1 Query: 179 IHLDYN*HKGSDNFTSMMFACLILENTL--QYW 87 +HLD +K ++ +++ +C ILEN + +YW Sbjct: 128 LHLDSVSYKDEESIRNLLSSCPILENLVVYEYW 160 >At1g76480.1 68414.m08897 expressed protein ; expression supported by MPSS Length = 177 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 203 IPNSTERIKRIFIIICSEKL 262 IPNS ER I+ I+C E+L Sbjct: 108 IPNSRERYFIIYNIVCEEQL 127 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,068,572 Number of Sequences: 28952 Number of extensions: 101194 Number of successful extensions: 123 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 331449360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -