BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30066 (515 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0035 - 9130678-9130887,9130963-9131255,9132328-9132604 29 2.9 08_02_0082 + 12059692-12060209,12060484-12060973 28 5.1 >11_03_0035 - 9130678-9130887,9130963-9131255,9132328-9132604 Length = 259 Score = 28.7 bits (61), Expect = 2.9 Identities = 18/64 (28%), Positives = 26/64 (40%) Frame = +2 Query: 47 DNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAILN 226 D ++L E + + V+ + NAAK Y E K K ++C F K Sbjct: 47 DKINLEEMLRHAEPEVPMGSVRGLNNFEALQNAAKEVMYDESKGCNKKIVCEFGKVTKKP 106 Query: 227 SDGT 238 S GT Sbjct: 107 SKGT 110 >08_02_0082 + 12059692-12060209,12060484-12060973 Length = 335 Score = 27.9 bits (59), Expect = 5.1 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -2 Query: 379 PL**HWKISKALSAASCPVLSLHCSSTLWASDLLTPG 269 PL H A+SAA C + C W S++ PG Sbjct: 33 PLTEHDDAISAMSAAHCNNMQFRCYRGFWISEMWAPG 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,276,751 Number of Sequences: 37544 Number of extensions: 225176 Number of successful extensions: 578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -