BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30063 (477 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 0.59 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 0.78 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 5.5 AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. 23 5.5 AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. 23 5.5 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 7.2 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 26.2 bits (55), Expect = 0.59 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -2 Query: 233 NLHERLYLGPLVDFILSHPLVHFPG 159 NLH G +V I +H VHFPG Sbjct: 498 NLHRCKLCGKVVTHIRNHYHVHFPG 522 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.8 bits (54), Expect = 0.78 Identities = 19/75 (25%), Positives = 33/75 (44%) Frame = +3 Query: 141 AGIDRYPRKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMQHVIQLTSALKNSAQKT*KTLQ 320 AGI + + + ++ K +K +K Y+ L+ S LKNS K K Sbjct: 333 AGILAKHDETYDALKAERVEKEKLVKEEIK--QYDELVSAKESKESTLKNSLDKFAKVQA 390 Query: 321 NVRSCVSTREYVLKR 365 N+R+ R+ L++ Sbjct: 391 NMRATNERRKKTLEQ 405 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 5.5 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -3 Query: 151 SIPATKACPYGLSEVPSS*FLTTIALRPAYRPLKTSTTLPG 29 + P T PYGLS SS L P P TLPG Sbjct: 1115 AFPVTPRTPYGLSNGTSSPAL------PPKSPTSQRITLPG 1149 >AJ007394-1|CAA07489.1| 112|Anopheles gambiae mucin protein. Length = 112 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 97 TTKVPPTSRTGMLSSLVSTGTPGKCT 174 TT V PT+ T + + +T PG+ T Sbjct: 40 TTTVAPTTTTTVAPTTTTTVAPGQTT 65 >AF046924-1|AAC08530.1| 122|Anopheles gambiae mucin protein. Length = 122 Score = 23.0 bits (47), Expect = 5.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 97 TTKVPPTSRTGMLSSLVSTGTPGKCT 174 TT V PT+ T + + +T PG+ T Sbjct: 40 TTTVAPTTTTTVAPTTTTTVAPGQTT 65 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.6 bits (46), Expect = 7.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 147 IDRYPRKVHKRMGKNKIHKRS 209 I+ Y VH R G+N I RS Sbjct: 122 IEEYVTMVHNRFGRNPIVIRS 142 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 456,033 Number of Sequences: 2352 Number of extensions: 8446 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -