BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30054 (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.5 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 23 7.2 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 9.6 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.5 Identities = 9/16 (56%), Positives = 11/16 (68%), Gaps = 2/16 (12%) Frame = -3 Query: 669 FDITHL--HYQWLDTH 628 FD +H+ H QWLD H Sbjct: 597 FDYSHIPTHLQWLDLH 612 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 23.4 bits (48), Expect = 7.2 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -1 Query: 644 SGWIRT*FVNSNYSII-SYNF 585 SG RT FVNS YS++ +Y F Sbjct: 135 SGGSRTAFVNSAYSLLKTYEF 155 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/34 (26%), Positives = 13/34 (38%) Frame = -3 Query: 228 NLVKSSPYHNNEGHYYHSLQSVHRAPYHQI*SHT 127 N + + H+ H Q H+ YH HT Sbjct: 300 NYILAQQQQQQHHHHQHQPQQQHQQQYHSHPHHT 333 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,568 Number of Sequences: 2352 Number of extensions: 11751 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -