BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30054 (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.1 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.1 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 5.1 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 5.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.9 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 654 LHYQWLDTHLIRKQQLLYNFLQLLH 580 L QW D L + Y FL +H Sbjct: 113 LQQQWYDPRLRYSNRSQYEFLNAIH 137 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 654 LHYQWLDTHLIRKQQLLYNFLQLLH 580 L QW D L + Y FL +H Sbjct: 113 LQQQWYDPRLRYSNRSQYEFLNAIH 137 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 654 LHYQWLDTHLIRKQQLLYNFLQLLH 580 L QW D L + Y FL +H Sbjct: 164 LQQQWYDPRLRYSNRSQYEFLNAIH 188 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 22.2 bits (45), Expect = 5.1 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -3 Query: 654 LHYQWLDTHLIRKQQLLYNFLQLLH 580 L QW D L + Y FL +H Sbjct: 113 LQQQWYDPRLRYSNRSQYEFLNAIH 137 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 5.1 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 635 IRT*FVNSNYSIISYNFFMQLPLIFTRYPFGS 540 +R+ F S S++ + + L +T+YPFG+ Sbjct: 4 VRSIFFLSLVSVVLLDTTQEEKLEWTKYPFGA 35 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.7 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 463 ERVDVTKLTQSRKIKYSLDNIRF*YID 543 E +D KLT +++DN R+ +D Sbjct: 1094 ELIDTEKLTDRLPYPWTMDNERYVKVD 1120 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 8.9 Identities = 11/38 (28%), Positives = 14/38 (36%) Frame = -3 Query: 117 YNEIGTTNMNTTRSHIINFLNLNT*RGPVSFHATRGNF 4 YN N N + N +N+ PV GNF Sbjct: 338 YNNYNNNNYNNYKKLYYNIINIEQIPVPVPVPIYCGNF 375 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,231 Number of Sequences: 438 Number of extensions: 3851 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -