BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30053 (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 25 0.58 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 7.2 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 25.4 bits (53), Expect = 0.58 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -2 Query: 457 HHPILGGVHSHHNRMPHPH 401 HH +G HSH + PH H Sbjct: 415 HHHTMGHGHSHIHATPHHH 433 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/48 (22%), Positives = 23/48 (47%) Frame = -1 Query: 155 NNQIIKNAFIWQILNTFPQIRVAHRKQSLSHNIPCYQY*QASNRVLFI 12 N + +A + + TFP + R+++L H + + + SN F+ Sbjct: 178 NIHLFHDASNFIAMETFPSVYSKTRRRALEHTLDRFHNDKYSNVPYFL 225 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,466 Number of Sequences: 438 Number of extensions: 4546 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -