BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30049X (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 24 3.7 AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding pr... 24 3.7 AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding pr... 23 4.9 AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding pr... 23 4.9 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 4.9 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 23 4.9 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 23 8.5 AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. 23 8.5 AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 23 8.5 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 23 8.5 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 23 8.5 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 23 8.5 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 23 8.5 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 23 8.5 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 23 8.5 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 23 8.5 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 8.5 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 8.5 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.8 bits (49), Expect = 3.7 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 150 ALTGNEVLKIVKQRLIKVDGKVRTDTTYPAGFMDVS 257 ++TG ++LK KQ+L +DG + ++ D+S Sbjct: 575 SVTGTKLLKKTKQQLEPLDGTLGWRRSHRPSLHDIS 610 >AF437889-1|AAL84184.1| 155|Anopheles gambiae odorant binding protein protein. Length = 155 Score = 23.8 bits (49), Expect = 3.7 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 8 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 154 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81 >AY146725-1|AAO12085.1| 155|Anopheles gambiae odorant-binding protein AgamOBP6 protein. Length = 155 Score = 23.4 bits (48), Expect = 4.9 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 8 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 154 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 33 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81 >AY146724-1|AAO12084.1| 151|Anopheles gambiae odorant-binding protein AgamOBP18 protein. Length = 151 Score = 23.4 bits (48), Expect = 4.9 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +2 Query: 8 AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 154 A ++L ++ ++ + R VC S ++A + G FP++ C+ Sbjct: 29 AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.4 bits (48), Expect = 4.9 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 430 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 341 AD AA +RY + + RH L + Q ++S Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 23.4 bits (48), Expect = 4.9 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -1 Query: 187 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 8 C + + PV +R R + RG +R+ PVD A +A KC Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +2 Query: 257 SIEKTNELFRLIYDVKGRFTIHRI 328 S+E N + IYD+KG+ ++ Sbjct: 177 SLEHLNLQYNFIYDIKGQVVFAKL 200 >AY752901-1|AAV30075.1| 90|Anopheles gambiae peroxidase 7 protein. Length = 90 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 70 AYTPPSLSNIHALGAFKRF 14 A+T PS+ N H AF+ F Sbjct: 64 AFTNPSVINSHTTAAFRFF 82 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 22.6 bits (46), Expect = 8.5 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 7/61 (11%) Frame = +2 Query: 5 EAFEALKRSQSMDVGQTWRCVCTETVN-------RSPQVARVLAPGDFPEESSEVCFDRK 163 E F+AL+++ +G + VC T++ + P V + F E VC D Sbjct: 337 ECFDALRKADIYAIGLIFWEVCRRTISCGIAEEYKVPYFDYVSSDPSFEEMRKVVCVDNY 396 Query: 164 R 166 R Sbjct: 397 R 397 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 67 MHRDRQPVPTSCASAC 114 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 67 MHRDRQPVPTSCASAC 114 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 67 MHRDRQPVPTSCASAC 114 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 67 MHRDRQPVPTSCASAC 114 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 67 MHRDRQPVPTSCASAC 114 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 67 MHRDRQPVPTSCASAC 114 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 67 MHRDRQPVPTSCASAC 114 M RD PT+CA C Sbjct: 249 MDRDNDGAPTNCAVTC 264 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 22.6 bits (46), Expect = 8.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 138 DSSGKSPGASTRATCGDRLTVSVHT 64 D++ +PGAS A RL VH+ Sbjct: 885 DANASNPGASRYARWAHRLIPEVHS 909 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 22.6 bits (46), Expect = 8.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 107 VLAPGDFPEESSEV 148 VLAPG PEES+ V Sbjct: 683 VLAPGRTPEESAAV 696 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 608,186 Number of Sequences: 2352 Number of extensions: 12800 Number of successful extensions: 77 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -