BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30047 (629 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53875| Best HMM Match : Glu_synthase (HMM E-Value=0) 29 3.1 SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) 29 3.1 SB_29489| Best HMM Match : Glu_syn_central (HMM E-Value=1.1e-05) 29 3.1 SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8) 28 7.2 SB_56997| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_53875| Best HMM Match : Glu_synthase (HMM E-Value=0) Length = 911 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 78 FKQLFAQLLFDYFKQLFAQLLFDYFK 103 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 90 FKQLFAQLLFDYFKQLFAQLLFDYFK 115 >SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) Length = 1075 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 869 FKQLFAQLLFDYFKQLFAQLLFDYFK 894 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 881 FKQLFAQLLFDYFKQLFAQLLFDYFK 906 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 893 FKQLFAQLLFDYFKQLFAQLLFDYFK 918 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 905 FKQLFAQLLFDYFKQLFAQLLFDYFK 930 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 917 FKQLFAQLLFDYFKQLFAQLLFDYFK 942 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 929 FKQLFAQLLFDYFKQLFAQLLFDYFK 954 >SB_29489| Best HMM Match : Glu_syn_central (HMM E-Value=1.1e-05) Length = 180 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 78 FKQLFAQLLFDYFKQLFAQLLFDYFK 103 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 90 FKQLFAQLLFDYFKQLFAQLLFDYFK 115 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 102 FKQLFAQLLFDYFKQLFAQLLFDYFK 127 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 114 FKQLFAQLLFDYFKQLFAQLLFDYFK 139 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 126 FKQLFAQLLFDYFKQLFAQLLFDYFK 151 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 138 FKQLFAQLLFDYFKQLFAQLLFDYFK 163 Score = 29.1 bits (62), Expect = 3.1 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 501 FKQLLMGLEGEYFRRLFVKNLFDEFE 424 FKQL L +YF++LF + LFD F+ Sbjct: 150 FKQLFAQLLFDYFKQLFAQLLFDYFK 175 >SB_5154| Best HMM Match : zf-C2H2 (HMM E-Value=1.8) Length = 180 Score = 27.9 bits (59), Expect = 7.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 510 CFSEFIFFFQYNYLHTIIHH 569 CFS F +YNY H HH Sbjct: 69 CFSRFTITTKYNYRHNYKHH 88 >SB_56997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 416 RQFSNSSNKFLTKSRRKYSPSRPINNCLNFR 508 +Q + S+KF+ KS+RK ++ I+N L + Sbjct: 50 KQLTQESSKFMQKSKRKKLMTKDIDNALRLQ 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,522,537 Number of Sequences: 59808 Number of extensions: 287970 Number of successful extensions: 499 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 495 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -