BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30047 (629 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 1.9 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 148 NK*YNKNCSGNYYTKINV 95 N YN NC YY IN+ Sbjct: 344 NNNYNNNCKKLYYNIINI 361 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.4 bits (48), Expect = 1.9 Identities = 14/58 (24%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Frame = +2 Query: 326 RDTGNKIVLVFEFSRYNKY----ILTDIPTCIIRRQFSNSSNKFLTKSRRKYSPSRPI 487 RD + + +++ ++ +KY ILT +P I ++ +KF++K +K ++ I Sbjct: 73 RDINDVLNVLYFINKNDKYEENTILTTMPLLINVVKYLGGKHKFISKKIKKTMENKDI 130 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,957 Number of Sequences: 438 Number of extensions: 3627 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -